DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_006539081.1 Gene:Zdhhc18 / 503610 MGIID:3527792 Length:407 Species:Mus musculus


Alignment Length:226 Identity:57/226 - (25%)
Similarity:104/226 - (46%) Gaps:57/226 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GPITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQALFLLLSTLAT--FNYVMATL-----TGP 72
            |.:.||:::..::.|.|:.  ::..|      :..:.|.|.:..:|.  |.:||:.|     |.|
Mouse    83 GGVFALTLLLILSTTILFF--VFDCP------YLARTLTLAIPIIAAILFFFVMSCLLQTSFTDP 139

  Fly    73 GLMPK-------------------QWHPKDPKDAQF--------LQYCKKCEGYKAPRSHHCRKC 110
            |::|:                   .:.| .|:..:.        |:||..|:.::.||:.||..|
Mouse   140 GILPRATICEAAALEKQIDNTGSSTYRP-PPRTREVMINGQTVKLKYCFTCKMFRPPRTSHCSVC 203

  Fly   111 DRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHL 175
            |.||::.||||||:.:|||..|:.:|..|:|  .|..|...:..|.     :.....|:.|...|
Mouse   204 DNCVERFDHHCPWVGNCVGRRNYRFFYAFIL--SLSFLTAFIFACV-----VTHLTLLSQGSNFL 261

  Fly   176 ASVQFT---LLSIIMCILGMGLAIGVVIGLS 203
            ::::.|   :|.:::|.    .:|..::|||
Mouse   262 SALKKTPASVLELVICF----FSIWSILGLS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 38/126 (30%)
Zdhhc18XP_006539081.1 DHHC 183..306 CDD:366691 38/117 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.