DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001034432.1 Gene:Zdhhc14 / 499014 RGDID:1565877 Length:489 Species:Rattus norvegicus


Alignment Length:201 Identity:52/201 - (25%)
Similarity:82/201 - (40%) Gaps:65/201 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FNYVMATL-----TGPGLMPKQWHPKDPKDAQ------------------------------FLQ 91
            |.:||.||     :.||::|:. .|.:..|.:                              .|:
  Rat   102 FFFVMGTLLRTSFSDPGVLPRA-TPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVKLK 165

  Fly    92 YCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCC 156
            ||..|:.::.||:.||..||.||::.||||||:.:|||..|:.:|..|:|     ||....|...
  Rat   166 YCFTCKIFRPPRASHCSLCDNCVEQFDHHCPWVGNCVGKRNYRFFYMFIL-----SLSFLTVFIF 225

  Fly   157 SFWRGIYRYYYLTHGLAHLASVQF---------TLLSIIMCILGMGLAIGVVIGLSMLLFIQLKT 212
            :|        .:||.:.......|         ::|..::|.    .::..:||||   ......
  Rat   226 AF--------VITHVIHRSQQKGFLDALKDSPASVLEAVICF----FSVWSIIGLS---GFHTYL 275

  Fly   213 IVNNQT 218
            |.:|||
  Rat   276 ISSNQT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 42/139 (30%)
Zdhhc14NP_001034432.1 DHHC 164..287 CDD:396215 42/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.