Sequence 1: | NP_650191.1 | Gene: | CG5196 / 41522 | FlyBaseID: | FBgn0038039 | Length: | 427 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034432.1 | Gene: | Zdhhc14 / 499014 | RGDID: | 1565877 | Length: | 489 | Species: | Rattus norvegicus |
Alignment Length: | 201 | Identity: | 52/201 - (25%) |
---|---|---|---|
Similarity: | 82/201 - (40%) | Gaps: | 65/201 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 FNYVMATL-----TGPGLMPKQWHPKDPKDAQ------------------------------FLQ 91
Fly 92 YCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCC 156
Fly 157 SFWRGIYRYYYLTHGLAHLASVQF---------TLLSIIMCILGMGLAIGVVIGLSMLLFIQLKT 212
Fly 213 IVNNQT 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5196 | NP_650191.1 | zf-DHHC | 89..223 | CDD:279823 | 42/139 (30%) |
Zdhhc14 | NP_001034432.1 | DHHC | 164..287 | CDD:396215 | 42/138 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |