DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc11

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_038942712.1 Gene:Zdhhc11 / 499000 RGDID:1564281 Length:364 Species:Rattus norvegicus


Alignment Length:218 Identity:56/218 - (25%)
Similarity:91/218 - (41%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SPEISGFRRFLHWGPITALSIIKCITLTTLYMNSMWWPPNKSFAG--FAHQALFLLLSTL--ATF 62
            ||.:..|:. :.|....|:||:...........|..:..|....|  ..|..:.|:..|:  |..
  Rat    38 SPPLHSFQA-ISWTTYLAMSIVTFGIFIPFLPTSWKYAANAVMGGVFMFHLVVHLIAITIDPADT 101

  Fly    63 NYVMATLTGPGLMPKQWHPKDPKDAQFL--QYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWIN 125
            |   ..|....|.|.....:. |.|..:  |||..||...:.::.||..|::||...||||.|:|
  Rat   102 N---VRLKKDYLEPVPTFDRS-KHAHVIQNQYCHLCEVTVSKKAKHCSSCNKCVSGFDHHCKWLN 162

  Fly   126 HCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLASVQFTLLSIIMCIL 190
            :|||..|:.:|.:.:..:..|.|...::|...|    .:|:...:||.             |..|
  Rat   163 NCVGKRNYWFFFFSVASAAFGLLGVLIILLYIF----IQYFVNPNGLR-------------MDPL 210

  Fly   191 GMGLAIGVVIGLSML-LFIQLKT 212
            ..|.|:.:..|.:.| :||::.:
  Rat   211 YKGAAVWIGAGWTCLSVFIEISS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 36/127 (28%)
Zdhhc11XP_038942712.1 DHHC 123..294 CDD:396215 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.