DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and CG17195

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster


Alignment Length:297 Identity:70/297 - (23%)
Similarity:116/297 - (39%) Gaps:71/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FRRFLHWGPITALSIIKCITLTTLYMN-SMWWPPNKSFAGFAHQALFLLLSTLATFNYV------ 65
            |.|.:|     .|||:..:..|..:.: .|::...|.|...|:: |:.:|.|..|.|.:      
  Fly    19 FVRIVH-----PLSIVFVLCSTAFFFSLQMFYIAPKVFGDIAYK-LYWILVTFITHNILGNMLAC 77

  Fly    66 MATLTGPGLMPKQWHPKDPKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGW 130
            ..|.:....:.|.....:|:|.....||:.|:..::|||.||..|:.|:.:.||||.:...|:|.
  Fly    78 YMTSSSVNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIGH 142

  Fly   131 ANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHG--LAHLASVQFTLL--SIIMCILG 191
            .|..:|.:|..:..||.:......|         .:.|.:|  ...|:||.|.|:  :......|
  Fly   143 NNQRFFFWFTFYLTLGLVTSFATFC---------MFILQNGGNFMSLSSVIFNLITRTFFQNYTG 198

  Fly   192 MGL-AIGVVIGLS------MLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLYPYDLG 249
            ... .|..::.:|      .:|..|::.:..|.|...|:             ||      .||||
  Fly   199 NTFETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIF-------------DC------TYDLG 244

  Fly   250 WRANLRLVFNDECQKRG---------------DGIEW 271
            :|.|.:.:..    :||               ||..|
  Fly   245 FRKNCQTIMG----QRGLWTFISPLLKSPLPHDGAHW 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 36/144 (25%)
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467511
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.