DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc13

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001382044.1 Gene:Zdhhc13 / 365252 RGDID:1309736 Length:622 Species:Rattus norvegicus


Alignment Length:317 Identity:69/317 - (21%)
Similarity:115/317 - (36%) Gaps:72/317 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GFRRFLHWGPITALSIIKCITLTTLYMNSMWWP---PNKSFAGFAHQALFLLLSTLATFNYVMAT 68
            |::..::...:..||.|..|.:|       |:.   |:.:.:.|....:|.:::.|..|....| 
  Rat   340 GYKNLVYLPTVFLLSSIFWIFMT-------WFILFFPDAAGSPFYFAFIFSIMAFLYFFYKTWA- 396

  Fly    69 LTGPGLMPKQWHPK--------DPKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWIN 125
             |.||........:        :.....|..:|..|...|..||.||..|:.||.:.|.||.|..
  Rat   397 -TDPGFTKASEEERKVNIVTLAETGSLDFRTFCTSCLIRKPLRSLHCHVCNSCVARFDQHCFWTG 460

  Fly   126 HCVGWANHAYFTYFLL-------FSILGSLQGTVVLCCSFWR--GIYRY------------YYLT 169
            .|:|:.||.::.:|||       :.|.||.......|.:.::  |::.|            |...
  Rat   461 RCIGFGNHHHYIFFLLSLSMVCDWIIYGSFVYWSNHCATTFKEDGLWTYLNQIVACSPWVLYIFM 525

  Fly   170 HGLAHLASVQFTLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYR 234
            ....|.:...|.|::.:..|..:||.....|.|........:|:...:|                
  Rat   526 LAAFHFSWSTFLLINQLFQIAFLGLTSHERISLLKQSRHMKQTLSLRKT---------------- 574

  Fly   235 NADCDDEFLYPYDLGWRANLRLVFNDECQKRGDGIEWP-VVEGCDQYTLTREQLAQK 290
                      ||:||:..||...|...|    .|:..| :::...|||:......:|
  Rat   575 ----------PYNLGFMQNLADFFQCGC----FGLVKPCIIDWTSQYTMVFHPAKEK 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 39/154 (25%)
Zdhhc13NP_001382044.1 Ank_2 66..>269 CDD:423045
ANK repeat 81..112 CDD:293786
ANK repeat 114..146 CDD:293786
ANK repeat 148..179 CDD:293786
ANK repeat 181..247 CDD:293786
DHHC 423..557 CDD:396215 35/133 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.