DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_038966311.1 Gene:Zdhhc18 / 362613 RGDID:1309334 Length:482 Species:Rattus norvegicus


Alignment Length:226 Identity:57/226 - (25%)
Similarity:104/226 - (46%) Gaps:57/226 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GPITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQALFLLLSTLAT--FNYVMATL-----TGP 72
            |.:.||:::..::.|.|:.  ::..|      :..:.|.|.:..:|.  |.:||:.|     |.|
  Rat    89 GGVFALTLLLILSTTILFF--IFDCP------YLARTLTLAIPIIAAILFFFVMSCLLQTSFTDP 145

  Fly    73 GLMPK-------------------QWHPKDPKDAQF--------LQYCKKCEGYKAPRSHHCRKC 110
            |::|:                   .:.| .|:..:.        |:||..|:.::.||:.||..|
  Rat   146 GILPRATICEAAALEKQIDNTGSSTYRP-PPRTREVMINGQMVKLKYCFTCKMFRPPRTSHCSVC 209

  Fly   111 DRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHL 175
            |.||::.||||||:.:|||..|:.:|..|:|  .|..|...:..|.     :.....|:.|...|
  Rat   210 DNCVERFDHHCPWVGNCVGRRNYRFFYAFIL--SLSFLTAFIFACV-----VTHLTLLSQGSNFL 267

  Fly   176 ASVQFT---LLSIIMCILGMGLAIGVVIGLS 203
            ::::.|   :|.:::|.    .:|..::|||
  Rat   268 SALKKTPASVLELVICF----FSIWSILGLS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 38/126 (30%)
Zdhhc18XP_038966311.1 DHHC 189..312 CDD:396215 38/117 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.