DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Patsas

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001356957.1 Gene:Patsas / 34634 FlyBaseID:FBgn0029137 Length:613 Species:Drosophila melanogaster


Alignment Length:290 Identity:69/290 - (23%)
Similarity:105/290 - (36%) Gaps:96/290 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LHWG---------PITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQALFLLLSTLATFNYVMA 67
            |.||         ||| .:|::......:|.|::.|                       .::.:|
  Fly   376 LLWGYPMYMIRAIPIT-WNILRRSHYCFIYWNAVMW-----------------------ISWAIA 416

  Fly    68 TLTGPGLMP----------KQ---WHPKDPKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDH 119
            ....||.:|          ||   :.....::....:.|..|...:..|:.|||.|:|||...||
  Fly   417 NRRDPGYIPLSSDAYYRAIKQIPYFDKLKKRNVMLTRLCHSCRCLRPLRAKHCRVCNRCVSYFDH 481

  Fly   120 HCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLASVQFTLL- 183
            |||:|.:|||..|..:|..|:|         :|.:.|||......|..:..|        ||:| 
  Fly   482 HCPFIYNCVGLRNRMWFFLFVL---------SVAVNCSFTIYFACYCVMIEG--------FTMLY 529

  Fly   184 ------SIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKAIY-----RRYRNAD 237
                  :::.|.||..|....::...|           |.|..|::..::..|     .||:|  
  Fly   530 VLGLIEAVVFCGLGWILTCTSILHACM-----------NLTTNEMFNYKRYPYLRDKRGRYQN-- 581

  Fly   238 CDDEFLYPYDLGWRANLRLVFNDECQKRGD 267
                   |:..|...|| |.|......|||
  Fly   582 -------PFSRGPILNL-LEFFVCLPDRGD 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 40/140 (29%)
PatsasNP_001356957.1 ANKYR 113..306 CDD:223738
ANK repeat 148..181 CDD:293786
ANK repeat 187..214 CDD:293786
ANK repeat 216..247 CDD:293786
ANK repeat 249..280 CDD:293786
ANK repeat 282..314 CDD:293786
Ank_4 283..336 CDD:316185
DHHC 455..567 CDD:334580 40/139 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467528
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.