DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and GABPI

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster


Alignment Length:293 Identity:65/293 - (22%)
Similarity:105/293 - (35%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLHWGPITALSIIKCITLTTLYMNSMWWPPNKSFA--GFAHQALFLLLS--TLATFNYVMATLTG 71
            ||.|   ...|:...|.:....:..:...|.:::|  .|:..||:.|.|  .|:..|.|.|..  
  Fly   150 FLSW---LVFSVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQY-- 209

  Fly    72 PGLMPKQWHP--------KDPKDAQ-FLQ-----------------------------YCKKCEG 98
             |..||...|        ::..:|| .||                             .|:.|..
  Fly   210 -GTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRK 273

  Fly    99 YKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIY 163
            ....|::||..|..|||:.|||..|:|.|:|..|:.::...|..|.:..|.|..:...|      
  Fly   274 VTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTS------ 332

  Fly   164 RYYYLTHGLAHLASVQFTLLSIIMC---ILGMGLAIGVVIG-LSMLLFIQLKTIVNNQTGIEIWI 224
                :.|....:..:.:.:|....|   ..|..|.|..|:. .::|:...:..|:..|.  .:|.
  Fly   333 ----ICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFILARQA--YLWW 391

  Fly   225 VEKAI--YRRYRNADCDDEFLYPYDLGWRANLR 255
            ....:  |:|..||...:...    ..|||.|:
  Fly   392 KGSTLHEYKRTSNAAGRNRIW----SNWRAILK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 34/166 (20%)
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 33/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467522
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.