DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc23

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001007461.1 Gene:Zdhhc23 / 332175 MGIID:2685625 Length:425 Species:Mus musculus


Alignment Length:312 Identity:69/312 - (22%)
Similarity:107/312 - (34%) Gaps:132/312 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLH---WGPITALSIIKCITLTTLYMNSMWWPPNKSFAGFAH----QALFLLLSTLATFNYV--- 65
            |||   |.     .::..:.||:|.|.::|      :....|    |.||.|...|.:..|:   
Mouse    96 FLHVASWH-----FLLGVVVLTSLPMLALW------YYYLTHRRKEQTLFFLSLGLFSLGYMYYV 149

  Fly    66 ---------------MATLT---------------GPGLMPKQWHPKDPKDAQF----------- 89
                           :|.||               .||.:.   :.|.|.::|.           
Mouse   150 FLREVVPQGRVGPTQLALLTCGLLLILLALYRAKKNPGYLS---NDKSPSNSQIECPVKKGQEKT 211

  Fly    90 ------------------------------------LQYCKKCEGYKAPRSHHCRKCDRCVKKMD 118
                                                ..:|.||:..:..|:.|||.|..||::||
Mouse   212 KGFPGTDASGSLNNRTLKDDVRGSSRVGLDSPAKVKEDWCAKCQLVRPARAWHCRICGICVRRMD 276

  Fly   119 HHCPWINHCVGWANHAYF----TYFLLFSILGSLQGTVVLCCS---------FWRGIYRYYYLTH 170
            |||.|||.|||.:||..|    :.|||.|:.| :..|:...|.         :..|:|..|    
Mouse   277 HHCVWINSCVGESNHQAFILALSIFLLTSVYG-ISLTLNTICRDRSLFTALFYCPGVYANY---- 336

  Fly   171 GLAHLASVQFTLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEI 222
                .:::.||      |:   ..::.:..|::.:..|||..|..|.|..|:
Mouse   337 ----SSALSFT------CV---WYSVIITAGMAYIFLIQLINISYNVTEREV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 45/194 (23%)
Zdhhc23NP_001007461.1 DHHC 248..374 CDD:396215 44/143 (31%)
Interaction with NOS1. /evidence=ECO:0000250 422..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.