DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and CG17075

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001245821.1 Gene:CG17075 / 33191 FlyBaseID:FBgn0031239 Length:968 Species:Drosophila melanogaster


Alignment Length:236 Identity:57/236 - (24%)
Similarity:97/236 - (41%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQALFLLLSTLATF---NYVMATLTGPGLMP- 76
            |:..|.|...:.| .|:..:.:|....:|.......|:.|::.|...   :::.|.||.|.... 
  Fly   109 PLHPLQIFGWLVL-LLFGVASYWVLIPAFHARIQGPLYGLITGLYLVHIASHLTALLTDPADKEL 172

  Fly    77 KQWHPKD--------PKDAQFLQ--YCKKCE-GYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGW 130
            ::.|..|        .|.:..::  .|..|. ...:.|:.||..|::||.|.||||.|:|||:|.
  Fly   173 RRVHRNDRIVPEFDRSKHSHVIENGRCHLCNIRTSSNRTKHCSVCNKCVGKFDHHCKWLNHCIGS 237

  Fly   131 ANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLASVQFTLLSIIMC------I 189
            .|:..|    |..::.::..|:|:..:....|..||           :|...||...|      .
  Fly   238 RNYVAF----LMCVVSAVVATLVIVAAVVAQIVFYY-----------IQPDWLSFYWCPTESSHT 287

  Fly   190 LGMGLAIGVVIGLS--MLLFIQLKTIVNNQTGIEIWIVEKA 228
            :..|..|.:.:.||  .::.|:..| .......|:|..|:|
  Fly   288 IESGDFINITLSLSNGTMMLIEQHT-SEEDVHQEMWDEEQA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 37/144 (26%)
CG17075NP_001245821.1 zf-DHHC 199..>282 CDD:279823 30/97 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.