DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc15

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001034190.1 Gene:Zdhhc15 / 317235 RGDID:1562075 Length:337 Species:Rattus norvegicus


Alignment Length:329 Identity:79/329 - (24%)
Similarity:123/329 - (37%) Gaps:112/329 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RRFLHWGPITALSIIKCITLTTLY-------MNSMWWPPNKSFAGFAHQALFLLLSTLATFNYVM 66
            ||.|.|.|:.   :|..:.|.:.|       :.::..|..|......:.|:|:..:    :.|..
  Rat    17 RRVLSWVPVL---VIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFA----WTYWK 74

  Fly    67 ATLTGPGLMPKQWH--------------PKDPKDAQFL------------------QYCKKCEGY 99
            :..|.|....:::|              |:..|  |.|                  ::|.:|...
  Rat    75 SIFTLPQQPNQKFHLSYTDKERYKNEERPEVQK--QMLVDMAKKLPVYTRTGNGAVRFCDRCHLI 137

  Fly   100 KAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQ-GTVVLC--CSFWRG 161
            |..|.|||..|..||.||||||||:|:|:|::|:.:|..||.:|:|..|. .|.|..  ..:|||
  Rat   138 KPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRG 202

  Fly   162 IYRYYYLTHGLAHLASVQ----FTLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEI 222
                        .|.||:    ...|..:.|:..:.|.|         ||           |...
  Rat   203 ------------ELPSVRSKFHVLFLLFVACMFFVSLVI---------LF-----------GYHC 235

  Fly   223 WIVEKAIYRRYRNADCDDEFLYP----------YDLGWRANLRLVFNDECQ--------KRGDGI 269
            |:|.       ||....:.|..|          ::||:..|::.||.|..:        ..|||.
  Rat   236 WLVS-------RNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDNKKFWLIPIGSSPGDGH 293

  Fly   270 EWPV 273
            .:|:
  Rat   294 SFPM 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 44/158 (28%)
Zdhhc15NP_001034190.1 zf-DHHC <125..308 CDD:303066 59/212 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..337 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.