DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc9

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001034105.2 Gene:Zdhhc9 / 302808 RGDID:1561389 Length:364 Species:Rattus norvegicus


Alignment Length:268 Identity:64/268 - (23%)
Similarity:101/268 - (37%) Gaps:101/268 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GFAHQALFLLLST-----------LAT-------------FNYVMATL-----TGPGLMPK---- 77
            |..:..|||:|.|           ||.             |.:.||||     :.||::|:    
  Rat    36 GIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPD 100

  Fly    78 -------------------QWHPKDPKDAQF------LQYCKKCEGYKAPRSHHCRKCDRCVKKM 117
                               |..|...|:.|.      |:||..|:.::.||:.||..||.||::.
  Rat   101 EAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERF 165

  Fly   118 DHHCPWINHCVGWANHAYFTYFLL-FSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLA----S 177
            ||||||:.:|||..|:.||..|:| .|:|     |:             |.....:.::|    .
  Rat   166 DHHCPWVGNCVGKRNYRYFYLFILSLSLL-----TI-------------YVFAFNIVYVALKSLK 212

  Fly   178 VQF---------TLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIE----IWIVEKAI 229
            :.|         |:|.:::|...:...:|:. |....|      :..|||..|    .|..:..:
  Rat   213 IGFLETLKETPGTVLEVLICFFTLWSVVGLT-GFHTFL------VALNQTTNEDIKGSWTGKNRV 270

  Fly   230 YRRYRNAD 237
            ...|.:.:
  Rat   271 QNPYSHGN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 42/157 (27%)
Zdhhc9NP_001034105.2 zf-DHHC 138..261 CDD:279823 42/147 (29%)
ANXA2R <284..>343 CDD:292349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.