DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001034422.1 Gene:Zdhhc25 / 300323 RGDID:1598341 Length:279 Species:Rattus norvegicus


Alignment Length:223 Identity:66/223 - (29%)
Similarity:104/223 - (46%) Gaps:34/223 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WGPITALSIIKCITLTTLYMNSMW-------WPPNKSFAGFAHQALFLLLSTLATFNYVMATLTG 71
            |..:..:.|:..:....|.::..|       .|.|......|:..:|.||::||..:::...||.
  Rat    29 WFILDPIGILCAMATWALVLSGGWVLVRDLLIPSNNMLYIVANGMIFHLLASLALVSHLRTMLTD 93

  Fly    72 PGLMPKQWHPKDPKDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYF 136
            ||.:|....|    ....:.||..|......|:.||..|.||::|.||||||:|:|||..|..||
  Rat    94 PGSVPLGNRP----GPDTVSYCPDCRSAIPKRAAHCAVCKRCIRKNDHHCPWVNNCVGEDNQKYF 154

  Fly   137 TYFLLFSILGSLQGTVVL-------CCSFWRGIYRYYYLTHGLAHLASVQFTLLSIIMCILGMGL 194
            ..|:::  :| |.||.||       .||:.||   .:..:..::..|.:.|.||..:|       
  Rat   155 LLFIMY--IG-LSGTHVLLLLGIPVLCSYARG---EWDSSSSVSPPAPILFLLLVALM------- 206

  Fly   195 AIGVVIGLSMLLFIQLKTIVNNQTGIEI 222
              |.|:. |::|..|:.||..::|..|:
  Rat   207 --GFVLS-SVMLCTQMCTIYTDKTTTEL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 48/141 (34%)
Zdhhc25NP_001034422.1 zf-DHHC 109..230 CDD:279823 47/136 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.