DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc22

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001034414.1 Gene:Zdhhc22 / 299211 RGDID:1308446 Length:263 Species:Rattus norvegicus


Alignment Length:280 Identity:73/280 - (26%)
Similarity:103/280 - (36%) Gaps:88/280 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ITALSIIKCITLTT------LYMNSMWWPPNKS--FA-GFAHQALFLLLSTLATFNYVMATLTGP 72
            :.|.:...||:|.|      |::.||...|..:  |: ...|.||||.||..|..||::.....|
  Rat     9 VVAPAYFLCISLVTFVLQLFLFLPSMREDPTATPLFSPAVLHGALFLFLSANALGNYILVVQNSP 73

  Fly    73 GLMPKQWHPKDPKDAQFLQYCKKCEGYKA-------PRSHHCRKCDRCVKKMDHHCPWINHCVGW 130
                      |...|        |:|..:       |.:|.||.|.|...:.||||.:..:|:|.
  Rat    74 ----------DDLGA--------CQGTSSQRPQRPPPSTHFCRVCARVTLRHDHHCFFTGNCIGS 120

  Fly   131 ANHAYFTYFLLFSILGSLQGTV--------VLCCSFWRGIYRYYYLTHGLAHLASVQFTLLSIIM 187
            .|...|..|.|::.|..|...|        ||..||          .|.||.|     |||...:
  Rat   121 RNMRNFILFCLYTSLACLYSMVAGVAYISAVLSISF----------AHPLAFL-----TLLPTSI 170

  Fly   188 CILGMGLAIGVVIGLSMLLFI--------------QLKTIVNNQTGIEIWIVEKAIYRRYRNADC 238
            .....|..:|..:.:.::|::              ||..|:..||..:   |.|.:..|.|    
  Rat   171 SQFFSGAVLGSDMFVILMLYLWFAVGLACAGFCCHQLLLILRGQTRYQ---VRKGVAVRAR---- 228

  Fly   239 DDEFLYPYDLGWRANLRLVF 258
                      .||.||:.||
  Rat   229 ----------PWRKNLQEVF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 40/162 (25%)
Zdhhc22NP_001034414.1 DHHC 91..218 CDD:396215 38/141 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.