DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5196 and ZDHHC1

DIOPT Version :9

Sequence 1:	NP_650191.1	Gene:	CG5196 / 41522	FlyBaseID:	FBgn0038039	Length:	427	Species:	Drosophila melanogaster
Sequence 2:	NP_037436.1	Gene:	ZDHHC1 / 29800	HGNCID:	17916	Length:	485	Species:	Homo sapiens

Alignment Length:	201	Identity:	47/201 - (23%)
Similarity:	64/201 - (31%)	Gaps:	86/201 - (42%)

- Green bases have known domain annotations that are detailed below.

  Fly     2 SPEISGFRRFLHWGPITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQALFLLLSTLATFNYVM 66
            |||:.|.|.                     ..|...|||:.             |..:|...|:.
Human    31 SPELQGQRS---------------------RRNGWSWPPHP-------------LQIVAWLLYLF 61

  Fly    67 ATLTGPG----LMPKQWHPK----------------------DPKDAQFLQ-------------- 91
            ..:.|.|    |:|..|.|.                      ||.||....
Human    62 FAVIGFGILVPLLPHHWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRDKSYAGPLPIFNRSQ 126

  Fly    92 --------YCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSL 148
                    :|..|....:.||.||..|::||...||||.|:|:|||..|:..|    |.|:..:|
Human   127 HAHVIEDLHCNLCNVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLF----LHSVASAL 187

  Fly   149 QGTVVL 154
            .|.::|
Human   188 LGVLLL 193

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5196	NP_650191.1	zf-DHHC	89..223	CDD:279823	25/88 (28%)
ZDHHC1	NP_037436.1	Mediates interaction with STING1. /evidence=ECO:0000269\|PubMed:25299331	1..271		47/201 (23%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..41		5/30 (17%)
		zf-DHHC	129..284	CDD:307600	25/69 (36%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	324..358
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	462..485
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5273
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810