DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001365948.1 Gene:Zdhhc8 / 27801 MGIID:1338012 Length:775 Species:Mus musculus


Alignment Length:227 Identity:69/227 - (30%)
Similarity:96/227 - (42%) Gaps:60/227 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LLLSTLATFNYVMATLTGPGLMPKQWHPKDPKDAQF----------------LQYCKKCEGYKAP 102
            |.|..||  |:.|||...||:.|:....:|.:| .|                :::|..|..|:.|
Mouse    54 LFLFVLA--NFSMATFMDPGVFPRADEDEDKED-DFRAPLYKNVDVRGIQVRMKWCATCHFYRPP 115

  Fly   103 RSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYY 167
            |..||..||.||:..||||||:|:|:|..|:.||..||| |:...:.|.|..      |:  .|.
Mouse   116 RCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLL-SLSAHMVGVVAF------GL--LYV 171

  Fly   168 LTH----GLAHLASVQFTLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKA 228
            |.|    |.||.     |:...:||:  .||....||||               ||..:.:|.:.
Mouse   172 LNHSEGLGAAHT-----TITMAVMCV--AGLFFIPVIGL---------------TGFHVVLVTRG 214

  Fly   229 IYRRYRNADCDDEF---LYPYDLGWRANLRLV 257
               |..|.....:|   :.|:..|...|:..|
Mouse   215 ---RTTNEQVTGKFRGGVNPFTRGCYGNVEHV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 48/153 (31%)
Zdhhc8NP_001365948.1 DHHC 99..224 CDD:396215 50/158 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.