DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and ZDHHC20

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens


Alignment Length:339 Identity:76/339 - (22%)
Similarity:131/339 - (38%) Gaps:102/339 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RRFLHWGPITALSIIKC---------ITLTTLYMNSMWWPPNKSFAGFAHQALFLLLSTLATFNY 64
            :|.:.|.|:..::.:..         :.:.|::.|      .::.....:...|.|...:..::|
Human    11 QRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGN------EENGKTVVYLVAFHLFFVMFVWSY 69

  Fly    65 VMATLTGPGLMPKQWH----PKDPKDAQF--------------------------LQYCKKCEGY 99
            .|...|.|....|:::    .|:..:.:|                          ::||:||:..
Human    70 WMTIFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLI 134

  Fly   100 KAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYR 164
            |..|:|||..||.|:.||||||||:|:|||::|:.:|..|||:|:         |.|.|......
Human   135 KPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSL---------LYCLFVAATVL 190

  Fly   165 YYYLTHGLAHLAS--VQFTLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEK 227
            .|::......|..  .:|.:|.:..              :|.:.||.:.::.:    ...|:|.|
Human   191 EYFIKFWTNELTDTRAKFHVLFLFF--------------VSAMFFISVLSLFS----YHCWLVGK 237

  Fly   228 AIYRRYRNADCDDEFLYP----------YDLGWRANLRLVFNDE--------CQKRGDGIEWPV- 273
                   |....:.|..|          :.||...|.|.||.||        ....|||..:|. 
Human   238 -------NRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLGDGCSFPTR 295

  Fly   274 VEGCD--QYTLTRE 285
            :.|.|  |.::|.:
Human   296 LVGMDPEQASVTNQ 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 41/161 (25%)
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 72/324 (22%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.