DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:317 Identity:79/317 - (24%)
Similarity:121/317 - (38%) Gaps:97/317 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 WPPNKSFAGFAHQALFLLLS---------------------------TLATFNYVMATLTGPGLM 75
            |.|:..||.| :..|.|.||                           .|..|:.|....:.||::
Mouse    24 WFPSSVFAAF-NVTLLLFLSGLFFGFPCRWLVQNGEWAFPAITGPLFILTFFSLVSLNFSDPGIL 87

  Fly    76 PKQWHPKDP---------KDAQFLQYCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWA 131
            .:....:||         :.|..|::|.||..::.||::||..|:.||:..||||.|:|:|:|..
Mouse    88 HRGSTKEDPMTVHVVRVNQRAFRLEWCPKCLFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIGHR 152

  Fly   132 NHAYFTYFLLFSIL--GSLQGTVVLCCSF-WRGIYRYYYLTHGLAHLASVQFTLLSIIMCILGMG 193
            |...|...:|...|  |:|   :|.|.:| :|..:..:.|..|:|.|.:|.              
Mouse   153 NFRLFMLLVLSLCLYSGAL---LVTCLTFLFRTRHLPFSLDKGMAILVAVP-------------- 200

  Fly   194 LAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLYPYDLGWRANLRLV- 257
             |.|.:|.|.:||.||..::...::..|    .|..|....|         |:|.|:..|..|. 
Mouse   201 -AAGFLIPLFLLLLIQALSVSRAESSYE----SKCRYHPEYN---------PFDQGFAKNWYLAM 251

  Fly   258 -------FNDE--CQKRGDGIEWPVVEGCDQYTLTREQLAQKEEKRARTRTFKCTRP 305
                   :..|  |.:|..|..|                .|::.|.:..|..|..||
Mouse   252 FAPLGPNYMSEVVCLQRPVGTAW----------------IQEKTKPSPPRRPKHCRP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 43/136 (32%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 28/74 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.