DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and dhhc-5

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_498488.2 Gene:dhhc-5 / 187870 WormBaseID:WBGene00020066 Length:244 Species:Caenorhabditis elegans


Alignment Length:219 Identity:59/219 - (26%)
Similarity:96/219 - (43%) Gaps:54/219 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FLLLSTLATFNYVMATLTGPGLMPKQWHPKDPKDAQFLQYCKK---------CEGYKAPRSHHCR 108
            |..|..:...:|..|:.|         .|...:|.:.:::|.|         |...|.||.||||
 Worm    44 FHFLWIIIVCSYFSASFT---------PPTKCRDVEKVEHCDKEIKEDVCQLCNYRKPPRWHHCR 99

  Fly   109 KCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLA 173
            :|:.||.:||||||.:..|:...||.||..||::    .||..:.   :.|.|.|.::.....: 
 Worm   100 RCNLCVHRMDHHCPILQLCIHSGNHKYFLLFLVW----PLQLAIF---TIWHGYYDFWKTIRSV- 156

  Fly   174 HLASVQFT--LLSIIMCILGMGLAIGVVIGLSMLLFI--QLKTIVNNQTGIEIWIVEKAIYRRYR 234
                  :|  :||....:.|.|::..:::|::.|..:  ||..::.|||.||         ....
 Worm   157 ------YTAEILSTSEQLKGTGVSNALMVGIAALYLLKNQLPNLMRNQTLIE---------ESRE 206

  Fly   235 NADCDDEFLYPYDLG-WRANLRLV 257
            |..        |:|| |:.|::.|
 Worm   207 NTS--------YNLGSWQENVKSV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 45/146 (31%)
dhhc-5NP_498488.2 zf-DHHC 77..202 CDD:279823 42/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.