DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and dhhc-7

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_492960.1 Gene:dhhc-7 / 173045 WormBaseID:WBGene00007637 Length:302 Species:Caenorhabditis elegans


Alignment Length:235 Identity:68/235 - (28%)
Similarity:101/235 - (42%) Gaps:65/235 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LFLLLSTL----------ATFNYVMAT---------LTGPGLMP----KQWHPKDP--------- 84
            ::|||.|.          |.||.::||         |:.||.:|    |..:..:|         
 Worm    28 IWLLLPTFGHSIWTVFHGAVFNCLLATTIVAHTRAMLSDPGTVPISSSKGQNTPNPVFSSDEEDE 92

  Fly    85 --KDAQFLQ------------YCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAY 135
              ::|.|..            .|.:|:..:.||:||||.|.|||:||||||||:|:|||..|..:
 Worm    93 SDEEAVFRHDHLNRSSATEWTMCTRCDSLRPPRAHHCRVCKRCVRKMDHHCPWVNNCVGEYNQKW 157

  Fly   136 FTYFLLFSILGSLQGTVVLC-CSFWRGIYRYY----YLTHGLAHLASVQFTLLSIIMCILGMGLA 195
            |..|:.:....|....:||| |..|...|...    .|...|.|...:...:|::...:.|:   
 Worm   158 FLQFIFYVGASSAYSLLVLCLCWVWHDAYGMTGIKGPLGENLYHAKVIHSIMLAMESALFGL--- 219

  Fly   196 IGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRN 235
              .|:.:|.   .||..|..::|.||      ::.||.||
 Worm   220 --FVLAVSC---DQLGAIFTDETAIE------SVQRRGRN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 48/150 (32%)
dhhc-7NP_492960.1 zf-DHHC 115..240 CDD:279823 45/132 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.