Sequence 1: | NP_650191.1 | Gene: | CG5196 / 41522 | FlyBaseID: | FBgn0038039 | Length: | 427 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492960.1 | Gene: | dhhc-7 / 173045 | WormBaseID: | WBGene00007637 | Length: | 302 | Species: | Caenorhabditis elegans |
Alignment Length: | 235 | Identity: | 68/235 - (28%) |
---|---|---|---|
Similarity: | 101/235 - (42%) | Gaps: | 65/235 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 LFLLLSTL----------ATFNYVMAT---------LTGPGLMP----KQWHPKDP--------- 84
Fly 85 --KDAQFLQ------------YCKKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAY 135
Fly 136 FTYFLLFSILGSLQGTVVLC-CSFWRGIYRYY----YLTHGLAHLASVQFTLLSIIMCILGMGLA 195
Fly 196 IGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRN 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5196 | NP_650191.1 | zf-DHHC | 89..223 | CDD:279823 | 48/150 (32%) |
dhhc-7 | NP_492960.1 | zf-DHHC | 115..240 | CDD:279823 | 45/132 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1491968at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |