DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and Zdhhc7

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_596885.1 Gene:Zdhhc7 / 170906 RGDID:620205 Length:308 Species:Rattus norvegicus


Alignment Length:233 Identity:70/233 - (30%)
Similarity:108/233 - (46%) Gaps:43/233 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PNKSF-AGFAHQALFLLLSTLATFNYVMATLTGPGLMPKQWHPKD------PKDAQFLQYCKKCE 97
            |:|.| ....:..||..|:.||..:::...||.||.:||....|:      .|..:.:..|.||.
  Rat    72 PSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCC 136

  Fly    98 GYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGI 162
            ..|..|:|||..|.||::||||||||:|:|||..|..:|..|.::..|.|:. .::||       
  Rat   137 CIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSIH-ALILC------- 193

  Fly   163 YRYYYLTHGLAHLASV--QFT-----------LLSIIMCILGMGLAIGVVIGLSMLLF-IQLKTI 213
                    ||..::.|  |:|           :|.:.:|:.|:     :....:.::| .|:.:|
  Rat   194 --------GLQFISCVRGQWTECSDFSPPITVILLVFLCLEGL-----LFFTFTAVMFGTQIHSI 245

  Fly   214 VNNQTGIEIWIVEKAIY-RRYRNADCDDEFLYPYDLGW 250
            .|::|.||....||..: ||.|.......|..|..|.|
  Rat   246 CNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLW 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 45/147 (31%)
Zdhhc7NP_596885.1 DHHC 131..258 CDD:396215 45/147 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.