Sequence 1: | NP_650191.1 | Gene: | CG5196 / 41522 | FlyBaseID: | FBgn0038039 | Length: | 427 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034706.1 | Gene: | ZDHHC19 / 131540 | HGNCID: | 20713 | Length: | 309 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 52/207 - (25%) |
---|---|---|---|
Similarity: | 90/207 - (43%) | Gaps: | 37/207 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 LSTLATFNYVMATLTGPGLMPKQWHPKDP---------KDAQFLQYCKKCEGYKAPRSHHCRKCD 111
Fly 112 RCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLA 176
Fly 177 SVQFTLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADCDDE 241
Fly 242 FLYPYDLGWRAN 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5196 | NP_650191.1 | zf-DHHC | 89..223 | CDD:279823 | 38/133 (29%) |
ZDHHC19 | NP_001034706.1 | DHHC | 109..>181 | CDD:366691 | 28/85 (33%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 280..309 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |