DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and zdhhc14

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_004914695.1 Gene:zdhhc14 / 100489334 XenbaseID:XB-GENE-998053 Length:481 Species:Xenopus tropicalis


Alignment Length:384 Identity:85/384 - (22%)
Similarity:134/384 - (34%) Gaps:149/384 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YVMATL-----TGPGLMPKQWHPKDPKDAQ------------------------------FLQYC 93
            :||.||     :.||::|:. .|.:..|.:                              .|:||
 Frog    96 FVMGTLLRTSFSDPGVLPRA-TPDEAADLERQIDVANGSTSGGYRPPPRTKEVVINGQTVKLKYC 159

  Fly    94 KKCEGYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSF 158
            ..|:.::.||:.||..||.||::.||||||:.:|||..|:.:|..|:|     ||....|...:|
 Frog   160 FTCKIFRPPRASHCSLCDNCVERFDHHCPWVGNCVGKRNYRFFYMFIL-----SLSFLTVFIFAF 219

  Fly   159 WRGIYRYYYLTHGLAHLASVQF---------TLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIV 214
                    .:||.:.......|         ::|..::|.    .::..::|||   ......|.
 Frog   220 --------VITHVILRSQQSGFLNALKDSPASVLEAVVCF----FSVWSIVGLS---GFHTYLIS 269

  Fly   215 NNQTGIE----IWIVEKAIYRRYRNADCDDEFLYPYDLGWRANLRLVFNDEC------------Q 263
            :|||..|    .|..::.           .|...||..|      .:|.:.|            .
 Frog   270 SNQTTNEDIKGSWSSKRG-----------KENYNPYSYG------NIFKNCCAALCGPVNPSLID 317

  Fly   264 KRG-------------DGIEWPVVEG--------CDQYTLTREQLAQKEE---KRARTRTFKCTR 304
            :||             :|:   .:.|        |||     :|..|..:   :.|.|...:...
 Frog   318 RRGFVPADMPQAVSPSNGL---TMYGSTQSQSNMCDQ-----DQCIQSTKFVLQAAATPLLQNEP 374

  Fly   305 PVTGRWLPIFSQGWRVCVAAPCSD------EPRISLRPN--------DMIKVTR-FRNH 348
            .||...||:   ..:..:.|||:.      .|..|: ||        |||.:.. ..||
 Frog   375 SVTSDELPL---PGKTSIHAPCTSLALGQPTPPSSM-PNLNSESILTDMIPLKEDLGNH 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 42/146 (29%)
zdhhc14XP_004914695.1 DHHC 156..279 CDD:366691 42/142 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.