DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and zdhhc7

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_002936046.1 Gene:zdhhc7 / 100485887 XenbaseID:XB-GENE-944330 Length:304 Species:Xenopus tropicalis


Alignment Length:214 Identity:64/214 - (29%)
Similarity:100/214 - (46%) Gaps:42/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PNKSF-AGFAHQALFLLLSTLATFNYVMATLTGPGLMPKQWHPKD------PKDAQFLQYCKKCE 97
            |::.| ....:..||..|:.||..:::...||.||.:||....|:      .|..:.:..|.||.
 Frog    69 PSRDFWYSVINGTLFNCLAVLALTSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCC 133

  Fly    98 GYKAPRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGI 162
            ..|..|:|||..|.||::||||||||:|:|||..|..:|..|.::..|.|.. .::||       
 Frog   134 SIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALISTY-ALILC------- 190

  Fly   163 YRYYYLTHGLAHLASV--QFT-----------LLSIIMCILGMGLAIGVVIGLSMLLF-IQLKTI 213
                    ||.....|  |:|           :|.|.:|:.|:     :.:..:.::| .|:.:|
 Frog   191 --------GLQLFTCVKGQWTACSSFSPPVTVILMIFLCLEGL-----LFLTFTAVMFGTQIHSI 242

  Fly   214 VNNQTGIEIWIVEKAIYRR 232
            .|::|.||....||..:.|
 Frog   243 CNDETEIERLKSEKPTWER 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 46/147 (31%)
zdhhc7XP_002936046.1 DHHC 128..255 CDD:366691 46/147 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.