DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and zdhhc16

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:XP_031760679.1 Gene:zdhhc16 / 100145301 XenbaseID:XB-GENE-957764 Length:371 Species:Xenopus tropicalis


Alignment Length:260 Identity:76/260 - (29%)
Similarity:103/260 - (39%) Gaps:54/260 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FAHQALFLLLSTLATFNYVMATLTGPGLMPKQWHPKDPKDAQFLQYCKKCEGYKAPRSHHCRKCD 111
            :.|..|.:::     |:|..|..|.|| .|.|.....|.    :..|:||..:|..|:|||..|.
 Frog   115 YGHWNLIMIV-----FHYYKAITTPPG-YPSQMETDIPS----VSICRKCIAHKPARTHHCSICS 169

  Fly   112 RCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSF-WRGIYRYYYLTHGLAHL 175
            |||.||||||||:|:|||..||.||..|.||..:|.:.      ||| .|.::|..|.......|
 Frog   170 RCVLKMDHHCPWLNNCVGHYNHRYFFSFCLFMTMGCIY------CSFSSRVMFREAYSAIEKMKL 228

  Fly   176 ASVQ-----------------FTLLSIIM--CILGMG-LAIGVVIGLSMLLFIQLKTIVNNQTGI 220
            ...:                 ||....:.  ||:.:. |...|.:.|..|.......|...:|.|
 Frog   229 QEKERLQFAANETYNDTPPPTFTFRERMFHKCIIYLWVLCSSVALALGALTLWHAMLITRGETSI 293

  Fly   221 EIWIVEKAIYRRYRNADCDDEFLYPYDLGWRANLRLVFNDECQKR--------------GDGIEW 271
            |..|.:|   .|.|.......|..||..|...|.::.|..|.:..              |:|:.|
 Frog   294 ERHINKK---ERKRLESIGKVFYNPYSYGRSGNWKVFFGVERKLHWVTRVALPSSHLPFGNGLTW 355

  Fly   272  271
             Frog   356  355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 51/154 (33%)
zdhhc16XP_031760679.1 DHHC 150..299 CDD:396215 52/154 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.