DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and zdhhc21

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001116527.1 Gene:zdhhc21 / 100144560 ZFINID:ZDB-GENE-080401-2 Length:263 Species:Danio rerio


Alignment Length:181 Identity:58/181 - (32%)
Similarity:91/181 - (50%) Gaps:21/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 AHQALFLLLSTLATFNYVM-ATLTGPGLMPKQWHPKDP-KDAQFLQYCKKCEGYKAPRSHHCRKC 110
            |...:...|::|..|:.:. |:.|.||.:.:.  ||.| .:....:.|.||...:..|||||.:|
Zfish    47 AEPVICYYLASLLCFSALFRASTTDPGKLAQD--PKIPLAERDNWELCNKCNMMRPKRSHHCSRC 109

  Fly   111 DRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHL 175
            ..||::|||||||||:|||..||..|.....::.:.|....|:..|.:      ||:|.  |:.:
Zfish   110 GHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTQVLSFYTLVLDFCQY------YYFLP--LSSV 166

  Fly   176 ASVQFTL-----LSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIE 221
            ....|.:     |..:.|.:|: :..|   |:|.|.:.|:|.|:.:.|.||
Zfish   167 DQADFAVHHELALLRVSCFMGL-IMFG---GISSLFYTQVKGILTDTTTIE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 47/138 (34%)
zdhhc21NP_001116527.1 zf-DHHC 87..217 CDD:279823 47/139 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.