DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5196 and zdhhc9

DIOPT Version :9

Sequence 1:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster
Sequence 2:NP_001096162.1 Gene:zdhhc9 / 100124706 XenbaseID:XB-GENE-1016830 Length:365 Species:Xenopus tropicalis


Alignment Length:267 Identity:61/267 - (22%)
Similarity:99/267 - (37%) Gaps:99/267 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GFAHQALFLLLSTLA------------------------TFNYVMATL-----TGPGLMPK---- 77
            |..:..|.|:|.|.:                        .|.:.||||     :.||::|:    
 Frog    36 GIFYLTLILILGTCSLFFAFECRYLAVHLSPAIPVFAAVLFLFAMATLLRTSFSDPGVIPRALPD 100

  Fly    78 -------------------QWHPKDPKDAQF------LQYCKKCEGYKAPRSHHCRKCDRCVKKM 117
                               |..|...|:.|.      |:||..|:.::.||:.||..||.||::.
 Frog   101 EAAFIEMEIEAANGNVPQGQRPPPRIKNVQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERF 165

  Fly   118 DHHCPWINHCVGWANHAYFTYFLL-FSILGSLQGTVVLCCSFWRGIYRYYYLTHGLAHLA----S 177
            ||||||:.:|||..|:.||..|:| .|:|     |:             |.....:.::|    |
 Frog   166 DHHCPWVGNCVGKRNYRYFYLFILSLSLL-----TI-------------YIFAFNIVYVALNSLS 212

  Fly   178 VQF---------TLLSIIMCILGMGLAIGVVIGLSMLLFIQLKTIVNNQTGIEI---WIVEKAIY 230
            :.|         |:|.:.:|...:...:|:. |....|     ..:|..|..:|   |..:..:.
 Frog   213 IGFLNTLKESPGTVLEVFICFFTLWSVVGLT-GFHTFL-----VSLNQTTNEDIKGSWTGKNRVQ 271

  Fly   231 RRYRNAD 237
            ..|.:.:
 Frog   272 NPYSHGN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 42/156 (27%)
zdhhc9NP_001096162.1 DHHC 138..261 CDD:366691 41/146 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.