DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f2 and ERG5

DIOPT Version :9

Sequence 1:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_013728.1 Gene:ERG5 / 855029 SGDID:S000004617 Length:538 Species:Saccharomyces cerevisiae


Alignment Length:381 Identity:83/381 - (21%)
Similarity:161/381 - (42%) Gaps:55/381 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 MRDARW--------KDMRSTLSPAFTGSKMRQ----MFQLMNQVAKEAVDCLKQDDSRVQENELD 181
            :|...|        .|.|.:|:..||...:.|    :.|:|::...:.|...|:::...|....:
Yeast   146 LRPCNWVFLDGKAHTDYRKSLNGLFTKQALAQYLPSLEQIMDKYMDKFVRLSKENNYEPQVFFHE 210

  Fly   182 MKD-YCTRFTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGLNKILK 245
            |:: .|             .|.:|||.....|..|:.|....:       :::..||:.:|..:.
Yeast   211 MREILC-------------ALSLNSFCGNYITEDQVRKIADDY-------YLVTAALELVNFPII 255

  Fly   246 VEL----FDRKSTQYFVRLVLDAMKYRQEHNIV--RPDMI-----NMLMEARGIIQTEKTKASAV 299
            :..    :.:|:....:::..:..:..::|...  :|..:     .::.:|:.  ..:.......
Yeast   256 IPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKN--SNDDDSRIYH 318

  Fly   300 REWSDRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYEAI 364
            ||:::::|....|.|.||..:.|:.|.|:....:.:..||..::.||...|..:....||..:.|
Yeast   319 REFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDMSTELNLDLI 383

  Fly   365 MGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTC--GFHRDPKYFE 427
            ..|||.:.|:.|.||..|..:.|.....|:  |.| .......||.:: :||.  ..| ||:.:|
Yeast   384 EKMKYTNMVIKETLRYRPPVLMVPYVVKKN--FPV-SPNYTAPKGAML-IPTLYPALH-DPEVYE 443

  Fly   428 NPMKFDPERFSDENKESIQPFTYFPFGLGQRNCIGSRFALLEAKAVI--YYLLKDY 481
            ||.:|.|||:.:.:|.|.....:..||.|...|:|..:.::...|::  :.|..|:
Yeast   444 NPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDF 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 83/381 (22%)
ERG5NP_013728.1 CYP61_CYP710 103..522 CDD:410703 83/381 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2429
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.