DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f2 and CYP72A9

DIOPT Version :9

Sequence 1:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_188081.2 Gene:CYP72A9 / 820691 AraportID:AT3G14630 Length:563 Species:Arabidopsis thaliana


Alignment Length:454 Identity:120/454 - (26%)
Similarity:201/454 - (44%) Gaps:98/454 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PLLMVRDPDLIKQITIKDFDHFINHRNVFATSSDDDPHDMSNLFGSSLFSMRDARWKDMRSTLSP 143
            |.:.:.:|.|||::..|.:|....|           ...:::|....|.:....:|...|..::|
plant   155 PAITIMNPQLIKEVYNKFYDFEKTH-----------TFPLTSLLTDGLANADGDKWVKHRKIINP 208

  Fly   144 AFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQEN----ELDMKDYCTRFTNDVIASTAFGLQVN 204
            ||...|::.|   :....|..::.:.:.:..|.:.    |||:..:....|.|||:.||||   :
plant   209 AFHFEKIKNM---VPTFYKSCIEVMCEWEKLVSDKGSSCELDVWPWIVNMTGDVISRTAFG---S 267

  Fly   205 SFKDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGLNKILKVELFDRKSTQYFVRLVLDAM---- 265
            |:|:.:..|           .||:....|.....|.|.|.....|..|:.:....:|.:..    
plant   268 SYKEGQRIF-----------ILQAELAHLIILALGKNYIPAYRHFPTKNNRRMKTIVKEIQVILR 321

  Fly   266 -------KYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVREWSDRDIVAQCFVFFFAGFETSA 323
                   |.|........|::.:|:::    .:|::|.:.:   :..:|:.:|.:|:|||.||::
plant   322 GIISHREKARDAGEAPSDDLLGILLKS----NSEQSKGNGL---NMEEIMEECKLFYFAGQETTS 379

  Fly   324 VLMCFTAHELMENQDVQQRLYEEVQQV----DQDLEGKELTYEAIMGMKYLDQVVNEVLRKWPAA 384
            ||:.:|...|.::||.|.|..|||.||    ..||:|       |..:|.:..::.||||.:|..
plant   380 VLLAWTMVLLSQHQDWQARAREEVMQVFGHNKPDLQG-------INQLKVMTMIIYEVLRLYPPV 437

  Fly   385 IAVDRECNKDITFDVDGQKVEVKKGDV-------IWLPTCGFHRDPKYF-ENPMKFDPERFSDE- 440
            |.::|..:|           |:|.||:       :.:|....|||.|.: ::..:|.||||.|. 
plant   438 IQMNRATHK-----------EIKLGDMTLPGGIQVHMPVLLIHRDTKLWGDDAAEFKPERFKDGI 491

  Fly   441 NKESIQPFTYFPFGLGQRNCIGSRFALLEAKAVIYYLLKDYRFAPAKKSCIPLELITSGFQLSP 504
            .|.:.....:.|||.|.|.|||..|||||||..:..:|:  ||:               |:|||
plant   492 AKATKNQVCFLPFGWGPRICIGQNFALLEAKMALALILQ--RFS---------------FELSP 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 120/454 (26%)
CYP72A9NP_188081.2 p450 59..563 CDD:386267 120/454 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.