DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f2 and CYP4F12

DIOPT Version :9

Sequence 1:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_076433.3 Gene:CYP4F12 / 66002 HGNCID:18857 Length:524 Species:Homo sapiens


Alignment Length:470 Identity:118/470 - (25%)
Similarity:203/470 - (43%) Gaps:78/470 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PLLMVRDPDLIKQITIKDFDHFINHRNVFATSSDDDPHDMSNLF--------GSSLFSMRDARWK 135
            |.:::..||.|:.||           |..|..:..|     |||        |..:......:|.
Human    97 PFIVLCHPDTIRSIT-----------NASAAIAPKD-----NLFIRFLKPWLGEGILLSGGDKWS 145

  Fly   136 DMRSTLSPAFTGSKMRQMFQLMNQVAKEAVD----CLKQDDSRVQENELDMKDYCTRFTNDVIAS 196
            ..|..|:|||..:.::....:.|:.|...:|    ...:..||     |||.::.:..|.|.:..
Human   146 RHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSSR-----LDMFEHISLMTLDSLQK 205

  Fly   197 TAFGLQVNSFKDRENTFYQMGKKLTTFT------FLQSMKFMLFFALKG---------LNKILKV 246
            ..|... :..::|.:.:.....:|:...      .||.|.|:.:.:..|         ::.....
Human   206 CIFSFD-SHCQERPSEYIATILELSALVEKRSQHILQHMDFLYYLSHDGRRFHRACRLVHDFTDA 269

  Fly   247 ELFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVREWSDRDIVAQC 311
            .:.:|:.| ...:.:.|..|.:.:...:  |.|::|:    :.:.|..||     .||.||.|:.
Human   270 VIRERRRT-LPTQGIDDFFKDKAKSKTL--DFIDVLL----LSKDEDGKA-----LSDEDIRAEA 322

  Fly   312 FVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYEAIMGMKYLDQVVNE 376
            ..|.|.|.:|:|..:.:..:.|..:.:.|:|..:|||::.:|.:.||:.::.:..:.:|...|.|
Human   323 DTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKE 387

  Fly   377 VLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDPKYFENPMKFDPERFSDEN 441
            .||..|.|..:.|.|.:||... ||:  .:.||....:...|.|.:|..:.:|..:||.||..||
Human   388 SLRLHPPAPFISRCCTQDIVLP-DGR--VIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFDPEN 449

  Fly   442 KESIQPFTYFPFGLGQRNCIGSRFALLEAKAVIYYLLKDYRF-----APAKKSCIPLELITSGFQ 501
            .:...|..:.||..|.|||||..||:.|.|.|:..:|..:||     .|.:|    ||||     
Human   450 SKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRK----LELI----- 505

  Fly   502 LSPKGGFWIKLVQRN 516
            :..:||.|:::...|
Human   506 MRAEGGLWLRVEPLN 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 116/462 (25%)
CYP4F12NP_076433.3 p450 52..506 CDD:306555 114/454 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.