DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f2 and CYP4F3

DIOPT Version :9

Sequence 1:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:425 Identity:96/425 - (22%)
Similarity:180/425 - (42%) Gaps:76/425 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GSSLFSMRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCL--------KQDDSRVQENE 179
            |..|......:|...|..|:|||..:.::...::.|    |:|:.:        .:..:|     
Human   133 GDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFN----ESVNIMHAKWQLLASEGSAR----- 188

  Fly   180 LDMKDYCTRFTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGLNKIL 244
            |||.::.:..|.|.:....|... :..:::.:.:.....:|:.....:..:.:|:.         
Human   189 LDMFEHISLMTLDSLQKCVFSFD-SHCQEKPSEYIAAILELSALVTKRHQQILLYI--------- 243

  Fly   245 KVELFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTE--------KTKASAV-- 299
                      .:...|..|..::|:...:|......::.|.|..:.::        |.|:..:  
Human   244 ----------DFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDF 298

  Fly   300 ------------REWSDRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQ 352
                        ::.||.||.|:...|.|.|.:|:|..:.:..:.|.::.:.|:|..:|||::.:
Human   299 IDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLK 363

  Fly   353 DLEGKELTYEAIMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTC 417
            |.|.||:.::.:..:.:|...:.|.||..|...||.|.|.:||... ||:  .:.||.:..:...
Human   364 DREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLP-DGR--VIPKGIICLISVF 425

  Fly   418 GFHRDPKYFENPMKFDPERFSDENKESIQPFTYFPFGLGQRNCIGSRFALLEAKAVIYYLLKDYR 482
            |.|.:|..:.:|..:||.||..:|.:...|..:.||..|.|||||..||:.|.|.|:...|..:|
Human   426 GTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFR 490

  Fly   483 F-----APAKKSCIPLELITSGFQLSPKGGFWIKL 512
            .     .|.:|.    ||:     |..:||.|:::
Human   491 VLPDHTEPRRKP----ELV-----LRAEGGLWLRV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 95/421 (23%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 96/422 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.