DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f2 and Cyp4ad1

DIOPT Version :9

Sequence 1:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster


Alignment Length:460 Identity:100/460 - (21%)
Similarity:186/460 - (40%) Gaps:88/460 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 DPHDMSNLFGSS-------------------LFSMRDARWKDMRSTLSPAFTGSKMRQMFQLMNQ 159
            ||.::.|:..||                   |.:...|||...:...:|||..|.:....:::::
  Fly    87 DPAEIQNILSSSSLLYKEHLYSFLRPWLGDGLLTSSGARWLKHQKLYAPAFERSAIEGYLRVVHR 151

  Fly   160 VAKEAVDCLKQDDSRVQENELDMKDYCTRFTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFT 224
            ...:.|.  |.|.....:...|.::...:.|.|::...|.|...:|.....:..:...|.|.  .
  Fly   152 TGGQFVQ--KLDVLSDTQEVFDAQELVAKCTLDIVCENATGQDSSSLNGETSDLHGAIKDLC--D 212

  Fly   225 FLQSMKFMLFFALKGLNKILKVELFDR--KSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEAR- 286
            .:|...|.:            |:.||.  :.|.|:       ||.|:..:::|.::..::.:.| 
  Fly   213 VVQERTFSI------------VKRFDALFRLTSYY-------MKQRRALSLLRSELNRIISQRRH 258

  Fly   287 -------------------GIIQTEKTKASAVREWSDRDIVAQCFVFFFAGFETSAVLMCFTAHE 332
                               .::.|.|.....::|   |:|:.:...|.|.|.:..|..:.||.:.
  Fly   259 QLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKE---REIIEEVSTFIFTGHDPIAAAISFTLYT 320

  Fly   333 LMENQDVQQRLYEEVQQVDQDLEGKELTYEAIMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITF 397
            |..:.::||:..||.:::..:....|.....:..|.||:.::.|.||.:|:...:.|.....|  
  Fly   321 LSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPI-- 383

  Fly   398 DVDGQKVEVKKGDVIWLPTCGFHRDPKYFENPMKFDPERFSD-ENKESIQPFTYFPFGLGQRNCI 461
            |::|.||......::.|...|::.  |||::|..|.||||.: .....|:.|...||..|.|.||
  Fly   384 DINGTKVAKCTTVIMCLIAMGYNE--KYFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRCI 446

  Fly   462 GSRFALLEAKAVIYYLLKDYRFAPA------------KKSCIPLE----LITSGFQLSPKGGFWI 510
            ..:||:.:.||::..||:.:...||            ::.|:|..    ::.....|..:.|..|
  Fly   447 AEKFAMYQMKALLSQLLRRFEILPAVDGLPPGINDHSREDCVPQSEYDPVLNIRVTLKSENGIQI 511

  Fly   511 KLVQR 515
            :|.:|
  Fly   512 RLRKR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 97/453 (21%)
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 91/412 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.