DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f2 and CYP4A22

DIOPT Version :9

Sequence 1:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:483 Identity:110/483 - (22%)
Similarity:186/483 - (38%) Gaps:83/483 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FDIVCDLYTKGGSKKFFGIFEQRQPLLMVRDPDLIKQITIKDFDHFINHRNVFATSSDDDPHD-- 117
            |...|..:..||..:           :.:.|||.:|               |....||...|.  
Human    82 FPSACPYWIWGGKVR-----------VQLYDPDYMK---------------VILGRSDPKSHGSY 120

  Fly   118 --MSNLFGSSLFSMRDARWKDMRSTLSPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENEL 180
              ::...|..|..:....|...|..|:|||....::....||....:..:|  |.::...|::.|
Human   121 KFLAPRIGYGLLLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLD--KWEELLGQDSPL 183

  Fly   181 DMKDYCTRFTNDVIASTAFGLQVNSFKDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGLNKILK 245
            ::..:.:..|.|.|..:||..|.:...||.:..|        ...:..:..::|..::       
Human   184 EVFQHVSLMTLDTIMKSAFSHQGSIQVDRNSQSY--------IQAISDLNSLVFCCMR------- 233

  Fly   246 VELFDRKSTQYFV----RLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVRE----- 301
             ..|....|.|.:    |....|.:...:|.    |.:..|.:|:...:.|..|....|.     
Human   234 -NAFHENDTIYSLTSAGRWTHRACQLAHQHT----DQVIQLRKAQLQKEGELEKIKRKRHLDFLD 293

  Fly   302 ------------WSDRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDL 354
                        .||:|:.|:...|.|.|.:|:|..:.:..:.|..:...|:|..||:..:..| 
Human   294 ILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGD- 357

  Fly   355 EGKELTYEAIMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTCGF 419
             |..:|:..:..|.|....:.|.||.:|....:.||.:..:||. ||:  .:.||.::.|...|.
Human   358 -GASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFP-DGR--SLPKGIMVLLSIYGL 418

  Fly   420 HRDPKYFENPMKFDPERFSDENKESIQPFTYFPFGLGQRNCIGSRFALLEAKAVIYYLLKDYRFA 484
            |.:||.:.|...|||.||:..:.:....|  .||..|.|||||.:||:.:.|......|..:...
Human   419 HHNPKVWPNLEVFDPSRFAPGSAQHSHAF--LPFSGGSRNCIGKQFAMNQLKVARALTLLRFELL 481

  Fly   485 PAKKSCIPLELITSGFQLSPKGGFWIKL 512
            | ..:.||:.:  :...|..|.|..::|
Human   482 P-DPTRIPIPM--ARLVLKSKNGIHLRL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 109/479 (23%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 109/480 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.