DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f2 and Cyp4a8

DIOPT Version :9

Sequence 1:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster
Sequence 2:XP_038965258.1 Gene:Cyp4a8 / 266674 RGDID:628846 Length:510 Species:Rattus norvegicus


Alignment Length:468 Identity:113/468 - (24%)
Similarity:191/468 - (40%) Gaps:94/468 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LMVRDPDLIKQITIKDFDHFINHRNVFATSSDDDPHD----MSNLFGSSLFSMRDARWKDMRSTL 141
            :.|.|||.:|.|..:               ||...|.    ::...|..|..:....|...|..|
  Rat    97 IQVYDPDYMKLILGR---------------SDPKSHHSYRFLAPWIGYGLLLLNGQTWFQHRRML 146

  Fly   142 SPAFTGSKMRQMFQLMNQVAKEAVDCLKQDDSRVQENELDMKDYCTRFTNDVIASTAFGLQVNSF 206
            :|||....::....:|....:..:|  |.:....|::.|::..:.|..|.|.|...||..:.:..
  Rat   147 TPAFHYDTLKPYVGIMADSVRIMLD--KWEQIVGQDSTLEIFQHITLMTLDTIMKCAFSQEGSVQ 209

  Fly   207 KDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGL---NKIL------------------------ 244
            .||:...|        ...::.:..:.||.::.:   |.|:                        
  Rat   210 LDRKYKSY--------IKAVEDLNNLSFFRIRNIFHQNDIIYSLSSNGRKARSAWQLAHEHTDQV 266

  Fly   245 ----KVELFDRKSTQYFVRLVLDAMKYRQEHNIVRPDMINMLMEARGIIQTEKTKASAVREWSDR 305
                |.:|.|.:..|          |.:|:.   |.|.:::|:.||  |:...:       .||:
  Rat   267 IKSRKAQLQDEEELQ----------KVKQKR---RLDFLDILLFAR--IENGSS-------LSDK 309

  Fly   306 DIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYEAIMGMKYL 370
            |:.|:...|.|.|.:|:|..:.:..:.|..|.:.||...:|:|.:..|  |..:|::.:..|.|.
  Rat   310 DLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQGCRKEIQSLLGD--GASITWDDLDKMPYT 372

  Fly   371 DQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDPKYFENPMKFDPE 435
            ...:.|.||.:|...||.|..:..:||. ||:  .:.||..:.|...|.|.:|..:.||..|||.
  Rat   373 TMCIKEALRIYPPVTAVSRMLSTPVTFP-DGR--SLPKGITVMLSFYGLHHNPTVWPNPEVFDPY 434

  Fly   436 RFSDENKESIQPFTYFPFGLGQRNCIGSRFALLEAKAVIYYLLKDYRFAP-AKKSCIPLELITSG 499
            ||:.|:  |....::.||..|.|||||.:||:.|.|..:...|..:...| ..:..||:..:.  
  Rat   435 RFAPES--SRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRIPIPIPRLV-- 495

  Fly   500 FQLSPKGGFWIKL 512
              |..|.|.:::|
  Rat   496 --LKSKNGIYLRL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 112/464 (24%)
Cyp4a8XP_038965258.1 CYP4B-like 72..505 CDD:410771 112/465 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.