DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f2 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus


Alignment Length:452 Identity:113/452 - (25%)
Similarity:181/452 - (40%) Gaps:70/452 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 FDHFINHRNVF------ATSSDDDPH--DMSNLF----GSSLFSMRDARWKDMRSTLSPAFTGSK 149
            |..|:...|::      |..|..||.  |:.:.|    |..|..:...:|...|..|:|.|....
  Rat    85 FGQFVGFLNIYEPDYAKAVYSRGDPKAADVYDFFLQWIGKGLLVLDGPKWFQHRKLLTPGFHYDV 149

  Fly   150 MRQMFQLMNQVAKEAVDCLKQDDSRVQENELDMKDYCT--RFTNDVIASTAFGLQVNSFKDRENT 212
            ::....:..:..:..:|  |.:....:....|:  :|.  ....|.:....||...:....|:|:
  Rat   150 LKPYVAIFAESTRMMLD--KWEKKASENKSFDI--FCDVGHMALDTLMKCTFGKGDSGLGHRDNS 210

  Fly   213 FYQMGKKLTTF------TFLQSMKFMLFFALKGLNKILKVELFDRKSTQYFVRLVLDAMKYRQEH 271
            :|.....||..      :|.....|:.:....| .:.|:........|...:|....|::..:|.
  Rat   211 YYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHG-RRFLRACKIAHDHTDEVIRQRKAALQDEKER 274

  Fly   272 NIVRP----DMINMLMEAR---GIIQTEKTKASAVREWSDRDIVAQCFVFFFAGFET-----SAV 324
            ..::.    |.:::|:..|   ||            :.||.::.|:...|.|.|.:|     |..
  Rat   275 KKIQQRRHLDFLDILLGVRDESGI------------KLSDAELRAEVDTFMFEGHDTTTSGISWF 327

  Fly   325 LMCFTAHELMENQDVQQRLYEEVQQV--DQDLEGKELTYEAIMGMKYLDQVVNEVLRKWPAAIAV 387
            |.|...:     .:.||...|||:.:  |||    ...::.:..|.||...:.|..|.:|....|
  Rat   328 LYCMALY-----PEHQQLCREEVRGILGDQD----SFQWDDLAKMTYLTMCMKECFRLYPPVPQV 383

  Fly   388 DRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDPKYFENPMKFDPERFSDENKESIQPFTYFP 452
            .|:.||.:|| |||:.:..  |.:|.|.....||:...:.:|..|||.|||.||.....||.:.|
  Rat   384 YRQLNKPVTF-VDGRSLPA--GSLISLHIYALHRNSTVWPDPEVFDPLRFSPENAAGRHPFAFMP 445

  Fly   453 FGLGQRNCIGSRFALLEAKAVIYYLLKDYRFA--PAKKSCIPLELITSGFQLSPKGGFWIKL 512
            |..|.|||||.:||:.|.|.|....|..:.|:  |:|......:||     |..|.|..:.|
  Rat   446 FSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDPSKMPIKVPQLI-----LRSKNGIHLYL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 112/448 (25%)
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 112/448 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.