DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9f2 and Cyp4a32

DIOPT Version :9

Sequence 1:NP_650189.1 Gene:Cyp9f2 / 41520 FlyBaseID:FBgn0038037 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001093651.1 Gene:Cyp4a32 / 100040843 MGIID:3717148 Length:509 Species:Mus musculus


Alignment Length:481 Identity:118/481 - (24%)
Similarity:191/481 - (39%) Gaps:120/481 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LMVRDPDLIKQITIKDFDHFINHRNVFATSSDDDPHDMSNL----FGSSLFSMRDARWKDMRSTL 141
            |.|.|||.:|               |....||...:.:..|    .|..|..:....|...|..|
Mouse    96 LTVYDPDYMK---------------VILGRSDPKANGIYRLLAPWIGYGLLLLNGQPWFQHRRML 145

  Fly   142 SPAFTGSKMRQMFQLMNQVAKEAVDCL-----KQDDSRVQENELDMKDYCTRFTNDVIASTAF-- 199
            :|||       .:.::....|...|.:     |.:....|::.:::..:.:..|.|.:...||  
Mouse   146 TPAF-------HYDILKPYVKNMADSIRLMLDKWERLAGQDSSIEIFQHISLMTLDTVMKCAFSH 203

  Fly   200 --GLQVN-SFKDRENTFYQMGKKLTTFTFLQSMKFMLFFALKGLNKILKV---ELFDRKSTQYFV 258
              .:||: ::|                |:||        |:..||.:...   .:|.:..|.|.:
Mouse   204 KGSVQVDGNYK----------------TYLQ--------AIGDLNNLFHSRVRNIFHQNDTIYRL 244

  Fly   259 ----RLVLDAMKYRQEH-------------------NIV---RPDMINMLMEARGIIQTEKTKAS 297
                ||...|.:...:|                   ||.   |.|.:::|:.||    .|...: 
Mouse   245 SSNGRLAKQACQLAHDHTDGVIKMRKDQLQDEGELENIKKKRRLDFLDILLFAR----MENGDS- 304

  Fly   298 AVREWSDRDIVAQCFVFFFAGFETSAVLMCFTAHELMENQDVQQRLYEEVQQVDQDLEGKELTYE 362
                .||:|:.|:...|.|.|.:|:|..:.:..:.|..:.:.|||..||||.:..|  |..:|::
Mouse   305 ----MSDKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPEHQQRCREEVQSLLGD--GSSITWD 363

  Fly   363 AIMGMKYLDQVVNEVLRKWPAAIAVDRECNKDITFDVDGQKVEVKKGDVIWLPTCGFHRDPKYFE 427
            .:..:.|....:.|.||.:|....:.||.:..:||. ||:  .:.||..:.|...|.|.:||.:.
Mouse   364 HLDQIPYTTMCIKEALRLYPPVPGIVRELSTSVTFP-DGR--SLPKGVQVTLSIYGLHHNPKVWP 425

  Fly   428 NPMKFDPERFSDENKESIQPFTYFPFGLGQRNCIGSRFALLEAKAVI------YYLLKDYRFAPA 486
            ||..|||.||:.::..  ...::.||..|.|||||.:||:.|.|.::      :.||.|....|.
Mouse   426 NPEVFDPSRFAPDSPR--HSHSFLPFSGGARNCIGKQFAMSELKVIVALTLLHFELLPDPTRVPE 488

  Fly   487 KKSCIPLELITSGFQLSPKGGFWIKL 512
                 ||..|.    |..|.|.::.|
Mouse   489 -----PLARIV----LKSKNGIYLHL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9f2NP_650189.1 p450 36..510 CDD:278495 117/477 (25%)
Cyp4a32NP_001093651.1 p450 52..503 CDD:278495 117/477 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.