DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAlig3 and LIG1

DIOPT Version :9

Sequence 1:NP_650187.2 Gene:DNAlig3 / 41518 FlyBaseID:FBgn0286075 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_000225.1 Gene:LIG1 / 3978 HGNCID:6598 Length:919 Species:Homo sapiens


Alignment Length:439 Identity:130/439 - (29%)
Similarity:195/439 - (44%) Gaps:92/439 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 PISPMLASPCKSVEDAFKKSPTGLYS-EIKYDGERVQIHK-QGNDFKFFSRNLK------PVVDH 310
            |:.||||.|.:.:.:..|:.....:: |.||||:|.|||. :|.:.|.||||.:      |.:..
Human   539 PLKPMLAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPDIIS 603

  Fly   311 KIRALKKYIPQAFPGGGEMILDSEIILVDTDTGALLPFGSLGAHKKQ----TFANAAVCLFVFDC 371
            :|..:|      .|.....|||:|.:..|.:...:.||..|...|::    :.....|||:.||.
Human   604 RIPKIK------LPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDL 662

  Fly   372 ILYDGEDLTQLPFRKRREILEQNIQPIKSHVQLSESEFLKTTRELAAMTARVLHANLEGVVLKS- 435
            |..:||.|.:.|..:||::|.:|....:.....:.|...|...::|....:.:..:.||:::|: 
Human   663 IYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTL 727

  Fly   436 -PTSTYQPGKR--NWLKVKKDYLFDGKMADTADLVVLGAWYGSGKKGGTLSIFLMGCYDAFGRLW 497
             ..:||:..||  ||||:||||| || :.||.||||:||:.|.||:.|....||:..||......
Human   728 DVDATYEIAKRSHNWLKLKKDYL-DG-VGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEEL 790

  Fly   498 KTVTKVHSGLDDATNAEVHKSLIKLT-------ERADANAIPS-WLLCSKSLVPDVLAKDPMKMP 554
            :.:.|:.:|..|....|.|:||..|.       .|.|...||. ||             ||  ..
Human   791 QAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWL-------------DP--SA 840

  Fly   555 VWEITGAEFTKSDAHTAS--------GISVRFPRITRRRSDKSAKEANDLAHLEDLFEASKSNVN 611
            |||:..|:.:.|..:.|:        |||:||||..|.|.||..::|...|.:..|:        
Human   841 VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLY-------- 897

  Fly   612 VDLLLANCSKDETAMNNKTTPEKEKKLNGNQSNGSKKLKRSNTGSDDED 660
                                 .|:.::...|...|        |||.||
Human   898 ---------------------RKQSQIQNQQGEDS--------GSDPED 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAlig3NP_650187.2 DNA_ligase_A_N 36..200 CDD:282522
dnl1 88..604 CDD:273147 122/381 (32%)
Adenylation_DNA_ligase_III 242..454 CDD:185712 65/215 (30%)
OBF_DNA_ligase_III 460..598 CDD:153436 50/153 (33%)
LIG1NP_000225.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..270
DUF4045 <10..275 CDD:330572
CDC9 164..914 CDD:330238 126/434 (29%)
Interaction with target DNA 449..458
Interaction with target DNA 642..644 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D274264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.