DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and MYL10

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_612412.2 Gene:MYL10 / 93408 HGNCID:29825 Length:226 Species:Homo sapiens


Alignment Length:227 Identity:51/227 - (22%)
Similarity:78/227 - (34%) Gaps:58/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 KFVSNDLGVPNASVP--PPAVL--------------EAASVVVK---QEKLQQEQASAA-----K 357
            :.|||..  |...:|  ||.||              .|:|.|..   |.::|:.:.|.|     :
Human     4 RLVSNSW--PQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLE 66

  Fly   358 ENSLMS---DVELSKPGRSFEQCKQTF---DSRVNKSGIFDSNQLLLAKHALGGVVIGGSRVLQC 416
            .|.::|   ::.|:....|.....|.|   |.  |:.|..|...|.....|||.:.:...     
Human    67 RNGMISAHCNLCLTGSSNSPASASQAFTIMDQ--NRDGFIDKEDLRDTFAALGRINVKNE----- 124

  Fly   417 RYEFEAQAPERV-QIRFHDFNVPTEHENSTGCQPGDA-LHVV----TELRGRYETQELLCGAFLP 475
              |.||...|.. .|.|..| :....|...|..|.:. ||..    ||.:|..:..      .:.
Human   125 --ELEAMVKEAPGPINFTVF-LTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKAD------VIK 180

  Fly   476 KPLMSSGQQLH----LQFVGKYPPTMTNKVQY 503
            :.||:...:..    .|....:||.:...:.|
Human   181 EKLMTQADRFSEEEVKQMFAAFPPDVCGNLDY 212

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity