DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and CUBN

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001072.2 Gene:CUBN / 8029 HGNCID:2548 Length:3623 Species:Homo sapiens


Alignment Length:604 Identity:129/604 - (21%)
Similarity:209/604 - (34%) Gaps:139/604 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GRLLGLRLRFQQPPTDLASWNLTLNASYRFLKRENFRTDGRLVPHSFCDFYFFASLSGEEANMGQ 212
            ||..|:.|   .||....|..|.:          ...|||...........:|....|.|.:...
Human  1348 GRYCGVDL---PPPGSTTSSKLQV----------LLLTDGVGRREKGFQMQWFVYGCGGELSGAT 1399

  Fly   213 GYFHSPQFPAHYPAHIKCAYKFIGRPDTHVEILFEELQLPPVVSGGCQLDALTLFDAESAHMNSV 277
            |.|.||.||..||.:.:|.:.....|.:.:::...:..:.  ....|..|.|.::.....|...:
Human  1400 GSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVE--YHSRCNFDVLEIYGGPDFHSPRI 1462

  Fly   278 IDVICSSRPTR---RLVSTGPDLLLEFNASSNRTAKGFRGKYKFVSNDLG----VPNASVPPPAV 335
            .. :|:.|...   ::.|||.:|.:.|....:...:||...::.|:...|    .|:..:..|..
Human  1463 AQ-LCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFNASWQAVTGGCGGIFQAPSGEIHSPNY 1526

  Fly   336 LEA------ASVVVKQEK------------LQQEQASAAKENSLMSDV----------ELSKP-- 370
            ...      .|.|::.::            |:.:.:.....:.|.|.:          :|:.|  
Human  1527 PSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEPQDSCIMAYDGLSSTMSRLARTCGREQLANPIV 1591

  Fly   371 --GRSFEQCKQTFDSRVNKSGIFDSNQLLLAKHALGGVVIGGS--------------RVLQCRYE 419
              |.|.....|:..||.|:.  |.:.    .:.|.||.::..|              ....|.:.
Human  1592 SSGNSLFLRFQSGPSRQNRG--FRAQ----FRQACGGHILTSSFDTVSSPRFPANYPNNQNCSWI 1650

  Fly   420 FEAQAP-ERVQIRFHDFNVPTEHENSTGCQPG-----DALHVVTELRGRYETQELLCGAFLPKPL 478
            .:||.| ..:.:.|..|    |.|.||.|...     |..|....|||||      ||..:|.|:
Human  1651 IQAQPPLNHITLSFTHF----ELERSTTCARDFVEILDGGHEDAPLRGRY------CGTDMPHPI 1705

  Fly   479 MSSGQQLHLQFV-------GKYPPTMTNKVQYYGFRAEYRFLTNFGIMSGIQKEGCSFVYNSSER 536
            .|....|.|:||       |.:..|:|..|                       ..|...:..:| 
Human  1706 TSFSSALTLRFVSDSSISAGGFHTTVTASV-----------------------SACGGTFYMAE- 1746

  Fly   537 ISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLHFTYFDIEGIGSCDHQTASDYIEFSNFMSTD 601
              |:|:||.:|..|..||.|.:....:...|:.|.|..|.:|....|    :.|::|.....:|.
Human  1747 --GIFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQDC----SRDFVEIREGNATG 1805

  Fly   602 RKFSRYCGKLPDFEMRSD---GRFFRVTLHSNDRFVAIGFRALYTFETVSVNNSITDLRDNASM- 662
            ....||||.  .|.:...   |....|...|:......||:|  ||..:..|::|.......:. 
Human  1806 HLVGRYCGN--SFPLNYSSIVGHTLWVRFISDGSGSGTGFQA--TFMKIFGNDNIVGTHGKVASP 1866

  Fly   663 ---QSFVSTASTQPVANVN 678
               :::...::.|...|||
Human  1867 FWPENYPHNSNYQWTVNVN 1885

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 26/125 (21%)
CUB <414..512 CDD:238001 31/110 (28%)
CUB 527..644 CDD:238001 31/119 (26%)
CUBNNP_001072.2 Interaction with AMN. /evidence=ECO:0000269|PubMed:30523278 42..49
EGF_CA 136..167 CDD:238011
EGF_CA 170..210 CDD:238011
EGF_CA 263..304 CDD:214542
EGF_3 309..347 CDD:289699
EGF_3 353..387 CDD:289699
EGF_CA 399..430 CDD:238011
EGF_CA 432..468 CDD:238011
CUB 474..585 CDD:238001
CUB 590..699 CDD:238001
CUB 708..815 CDD:238001
CUB 817..927 CDD:238001
CUB 932..1041 CDD:238001
CUB 1048..1157 CDD:294042
CUB 1165..1275 CDD:238001
CUB 1282..1388 CDD:238001 11/52 (21%)
CUB 1391..1505 CDD:238001 25/116 (22%)
CUB 1510..1617 CDD:238001 17/112 (15%)
CUB 1620..1733 CDD:238001 32/122 (26%)
CUB 1738..1847 CDD:238001 31/119 (26%)
CUB 1859..1962 CDD:238001 4/27 (15%)
CUB 1978..2088 CDD:278839
CUB 2092..2212 CDD:238001
CUB 2217..2333 CDD:238001
CUB 2336..2447 CDD:238001
CUB 2452..2564 CDD:238001
CUB 2570..2686 CDD:238001
CUB 2689..2800 CDD:238001
CUB 2805..2918 CDD:238001
CUB 2920..3034 CDD:238001
CUB 3037..3148 CDD:238001
CUB 3157..3273 CDD:238001
CUB 3278..3392 CDD:238001
CUB 3395..3506 CDD:238001
CUB 3511..3621 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR47537
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.