DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and pcolceb

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001122259.1 Gene:pcolceb / 794872 ZFINID:ZDB-GENE-080722-44 Length:538 Species:Danio rerio


Alignment Length:339 Identity:71/339 - (20%)
Similarity:115/339 - (33%) Gaps:133/339 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LSGEEANMGQGYFHSPQFPAHYPAHIKCAYKFIGRPDTHVEIL---FEELQLPPVVSGGCQLDAL 264
            |.|.......|:..|..||:||.|:.||.: :|..|:.||.:|   ..:|:..|.    |:.|.:
Zfish    34 LCGGHLVTDSGFVASEGFPSHYKANSKCTW-YITVPEGHVVMLQFRIFDLEADPT----CRYDYV 93

  Fly   265 TLFDAESAHMNSVIDVICSSRPTRRLVSTGPDLLLEFNASSNRTAKGF-----RGK-----YKFV 319
            .:::..|..:.. :...|.:.....|:||...::||..:.|:...:||     .||     ::|.
Zfish    94 DVYNGHSYTVQK-LGRFCGTFRPGALISTSNTMMLEMASDSSTGGRGFLAYFSGGKPHVDEHQFC 157

  Fly   320 SNDLGVPNASVPPP----------------AVLEAASVV-VKQEKLQQEQASAAKENSLMSDVEL 367
            ...|..|..||..|                ..:|:..|: ||.|||               |:||
Zfish   158 GGRLTKPQGSVKTPNWPESDYPAGISCSWHISVESNMVIEVKFEKL---------------DLEL 207

  Fly   368 SKPGRSFEQCKQTFDSRVNKSGIFDSNQLLLAKHALGGVVIGGSRVLQCRYEFEAQAPERVQIRF 432
                       .|:                                  |||::.|.         
Zfish   208 -----------DTY----------------------------------CRYDYVAL--------- 218

  Fly   433 HDFNVPTEHENSTGCQPGDALHVVTELRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTM 497
              ||         |.:..|:..:     |::      ||..:|..::::|.:|.:.||.....|.
Zfish   219 --FN---------GGETDDSRRI-----GKF------CGDTVPDAVVTNGNELLVHFVSDLSVTA 261

  Fly   498 TNKVQYYGFRAEYR 511
            .      ||.|.||
Zfish   262 A------GFMAHYR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 32/127 (25%)
CUB <414..512 CDD:238001 22/98 (22%)
CUB 527..644 CDD:238001
pcolcebNP_001122259.1 CUB 35..145 CDD:238001 29/115 (25%)
CUB 157..270 CDD:238001 38/210 (18%)
Hc1 <334..398 CDD:284776
NTR_like 416..538 CDD:295338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5088
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.