DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and KREMEN2

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_757384.1 Gene:KREMEN2 / 79412 HGNCID:18797 Length:462 Species:Homo sapiens


Alignment Length:341 Identity:77/341 - (22%)
Similarity:111/341 - (32%) Gaps:105/341 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SWNLTLNASYRFLKRENFR------------------TDGRLVPHSFCDFYFF---ASLSGEEAN 209
            |..||:....||.:.:.::                  ..|||.|.:.||...|   ..|.|.:..
Human   144 STKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGR 208

  Fly   210 MG----------------QGYFHSPQFPAHYPAHIKCAYKFIGRPDTHVEILFEELQLPPVVSGG 258
            :|                ||..:||.||..|.....|::. :|.|...:|:.|...:|..     
Human   209 LGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWA-LGPPGAALELTFRLFELAD----- 267

  Fly   259 CQLDALTLFDAESAHMNSVIDVICSSRPTRRLVSTGP------DLLLEFNASSNRTAKGFRGKYK 317
             ..|.|.|.||.|..:....|   .:||.    .:||      .|||.|.:.:...|:||...|:
Human   268 -PRDRLELRDAASGSLLRAFD---GARPP----PSGPLRLGTAALLLTFRSDARGHAQGFALTYR 324

  Fly   318 FV---SNDLGVPNASVPPPAV-LEAASVVVKQEKLQQEQASAAKENSLMSDVE--------LSKP 370
            .:   :.|...|..|...||. |:.|:|...........|..|:..|.::.|.        |.:|
Human   325 GLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPGAPPAAIGARVFSTVTAVSVLLLLLLGLLRP 389

  Fly   371 GRSFEQCKQTFDSRVNKSGIFDSNQLLLAKHALGGVVIGGSRVLQCRYEFEAQAPERVQIRFHDF 435
            .|. ..|                   |||. ..|...:|.||..:..:....|.|..|.:     
Human   390 LRR-RSC-------------------LLAP-GKGPPALGASRGPRRSWAVWYQQPRGVAL----- 428

  Fly   436 NVPTEHENSTGCQPGD 451
                      .|.|||
Human   429 ----------PCSPGD 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 38/147 (26%)
CUB <414..512 CDD:238001 7/38 (18%)
CUB 527..644 CDD:238001
KREMEN2NP_757384.1 KR 35..119 CDD:238056
WSC 124..205 CDD:280068 13/60 (22%)
CUB 219..324 CDD:238001 31/118 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..352 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.