DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and Pcolce2

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_083896.1 Gene:Pcolce2 / 76477 MGIID:1923727 Length:414 Species:Mus musculus


Alignment Length:250 Identity:58/250 - (23%)
Similarity:93/250 - (37%) Gaps:59/250 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 GGVVIGGSRVLQ------CRYEFEAQAPERVQIRFHDFNVPTEHENSTGCQPGDALHVVTELRGR 462
            |.||:...|.:.      |||:|              .:|...|.|      |..:       ||
Mouse    67 GKVVVLNFRFIDLENDNLCRYDF--------------VDVYNGHAN------GQRI-------GR 104

  Fly   463 YETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGFRAEYRFLTNFGIMSGIQKEGC 527
            :      ||.|.|..|::||.::.:|.:.......:      ||.|.|......|       :|.
Mouse   105 F------CGTFRPGSLVASGNKMTVQMISDANTAGS------GFMATYSAAAPDG-------KGD 150

  Fly   528 SFVYNSSERISGLFHSPNFPGY-YLENVVCNYYFYGASDERVVLHFTYFDIEGIGSCDHQTASDY 591
            .:.....|:.||.|.:||:|.. |...|.|.::.....::.:.|.|..||:|....|.:    ||
Mouse   151 RYCGGRLEKPSGTFKTPNWPDRDYPVGVTCVWHIIAPKNQLIELKFEKFDVERDNYCRY----DY 211

  Fly   592 IEFSN--FMSTDRKFSRYCGKLPDFEMRSDGRFFRVTLHSNDRFVAIGFRALYTF 644
            :...|  .::..::..:|||..|...:.|:.....:...|:....|.||...|.|
Mouse   212 VAVFNGGEVNDAKRIGKYCGDSPPVPIVSERNELLIQFLSDLSLTADGFIGHYKF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 22/103 (21%)
CUB 527..644 CDD:238001 29/119 (24%)
Pcolce2NP_083896.1 CUB 32..142 CDD:238001 26/113 (23%)
CUB 153..264 CDD:278839 28/114 (25%)
NTR_PCOLCE 291..414 CDD:239631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4379
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.