DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and Tll1

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001099551.1 Gene:Tll1 / 678743 RGDID:1306120 Length:1013 Species:Rattus norvegicus


Alignment Length:757 Identity:138/757 - (18%)
Similarity:252/757 - (33%) Gaps:223/757 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SFTVSHWPLTM-PAASLALGLTVV------------------------LLATGNGQSQQAVTNSK 43
            |:|...|.::: |...:.|..|.:                        ||....|.....|..|.
  Rat   371 SYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKVAGVLTST 435

  Fly    44 QSHFWLDCSCLHLSERNATQW---GRLAI-------------------NASHSLGAKNNCL-MIF 85
            .|..|::.       |:::.|   |..|:                   |..........|: .|.
  Rat   436 DSRMWIEF-------RSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIM 493

  Fly    86 IAGMDDELVAFQLEQLQLRAGC-LDSVDIFPYLREPVIENATLAADTFCQHSRERSATPIYSAGR 149
            ::......:.||..:::....| .|.:::    |:...||:.|.. .||.:.:            
  Rat   494 VSEGYHVGLTFQAFEIERHDSCAYDHLEV----RDGNSENSPLIG-RFCGYDK------------ 541

  Fly   150 LLGLRLRFQQPPTDLASWNLTLNASYRFLKRENFRTDGRLVPHSFCDFYFFASLSGEEANMG--- 211
                       |.|:.|.:.||     ::|   |.:||.:....|...:|.......:|:.|   
  Rat   542 -----------PEDIRSTSNTL-----WMK---FVSDGTVNKAGFAANFFKEEDECAKADRGGCE 587

  Fly   212 --------------------------------------QGYFHSPQFPAHYPAHIKCAYKFIGRP 238
                                                  .|...:|.:|..||.:..|.::.|...
  Rat   588 QRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVIAPS 652

  Fly   239 DTHVEILFEELQLPPVVSGG--CQLDALTLFDAESAHMNSVIDVICSSRPTRRLVSTGPDLLLEF 301
            ...:.:.||..:|    .|.  |:.|.:.::...|:. :.:....|.:.....:.|...::.:||
  Rat   653 QYRISVKFEFFEL----EGNEVCKYDYVEIWSGLSSE-SKLHGKFCGADVPEVITSHFNNMRIEF 712

  Fly   302 NASSNRTAKGFRGKYKFVSNDLGVPNASVPPPAVLEAASVVVKQEKLQQEQASAAKENSLMSDVE 366
            .:.:..:.|||:..: |...|                               ..:|:|.......
  Rat   713 KSDNTVSKKGFKAHF-FSDKD-------------------------------ECSKDNGGCQHEC 745

  Fly   367 LSKPGRSFEQCKQTFDSRVNKSGIFDS--NQLLLAKHALGGVVIG-------GSRVLQCRYEFEA 422
            ::..|....||:..|....||....::  .|.:   |:..|::..       .|| .:|.:...|
  Rat   746 VNTMGSYTCQCRNGFVLHENKHDCKEAECEQKI---HSPSGLITSPNWPDKYPSR-KECTWAISA 806

  Fly   423 QAPERVQIRFHDFNVPTEHENSTGCQPGDALHVVTELRGRYETQEL---LCGAFLPKPLMSSGQQ 484
            ....|:::.|::|.|....|.:.     |.|.:   ..|:.|...:   |||:.:|.|||::|.:
  Rat   807 IPGHRIKLAFNEFEVEQHQECAY-----DHLEI---FDGQTEKSPILGRLCGSKIPDPLMATGNE 863

  Fly   485 LHLQFVGKYPPTMTNKVQYYGFRAEYRFLTNFGIMSGIQKEGCSFVYNSSERISGLFHSPNFPGY 549
            :.::|:.      ...||..||:|.:.  |..|.....:::. ..:|:.::     |...|:|| 
  Rat   864 MFIRFIS------DASVQRKGFQATHS--TECGGRLKAERKP-KDLYSHAQ-----FGDNNYPG- 913

  Fly   550 YLENVVCNYYFYGASDERVVLHFTYFDIEGIGSCDHQTASDYIE-FSNFMSTDRKFSRYCGKLPD 613
               .:.|.:........|:.|.|..|::|....|.:    ||:| |....|......|:||..|.
  Rat   914 ---QLDCEWLLVSEQGSRLELSFQTFEVEEEADCGY----DYVEVFDGLNSKAVGLGRFCGSGPP 971

  Fly   614 FEMRSDGRFFRVTLHSNDRFVAIGFRALYTF----ETVSVNN 651
            .|:.|.|....:..|::|.....||...|..    ||:...|
  Rat   972 EEIYSIGDVALIHFHTDDTINKKGFYIRYKSIRYPETMHAEN 1013

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 24/165 (15%)
CUB <414..512 CDD:238001 25/100 (25%)
CUB 527..644 CDD:238001 29/117 (25%)
Tll1NP_001099551.1 ZnMc_BMP1_TLD 148..347 CDD:239808
Astacin 155..348 CDD:279708
CUB 349..458 CDD:278839 17/93 (18%)
CUB 462..571 CDD:278839 23/144 (16%)
FXa_inhibition 582..614 CDD:291342 1/31 (3%)
CUB 618..727 CDD:278839 21/113 (19%)
FXa_inhibition 734..769 CDD:291342 8/34 (24%)
CUB 774..883 CDD:278839 30/126 (24%)
CUB 887..1000 CDD:278839 29/126 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.