DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and Myl12a

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001344749.1 Gene:Myl12a / 67268 MGIID:1914518 Length:178 Species:Mus musculus


Alignment Length:151 Identity:31/151 - (20%)
Similarity:42/151 - (27%) Gaps:70/151 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 ENSTGCQPGDALHVVTELRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYPPTMTNKVQYYGF 506
            :|..|....:.||.:....|:..|.|.|.......|             |....||         
Mouse    49 QNRDGFIDKEDLHDMLASMGKNPTDEYLDAMMNEAP-------------GPINFTM--------- 91

  Fly   507 RAEYRFLTNFGIMSGIQKEGCSFVYNSSERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLH 571
                 |||.||                 |:::|.  .|       |:|:.|             .
Mouse    92 -----FLTMFG-----------------EKLNGT--DP-------EDVIRN-------------A 112

  Fly   572 FTYFDIEGIGSCDHQTASDYI 592
            |..||.|.||:..    .||:
Mouse   113 FACFDEEAIGTIQ----EDYL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 12/69 (17%)
CUB 527..644 CDD:238001 14/66 (21%)
Myl12aNP_001344749.1 FRQ1 25..175 CDD:227455 31/151 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.