DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and Myl10

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_017176539.1 Gene:Myl10 / 59310 MGIID:1891705 Length:232 Species:Mus musculus


Alignment Length:200 Identity:45/200 - (22%)
Similarity:64/200 - (32%) Gaps:57/200 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 PNASVPPPAVLEAASVVVKQEKLQQEQASAAKENSLMSDVELSKPGRSFEQCKQTF---DSRVNK 387
            |..|...|...:|...:..:...::.:.:|:.....|.|..      ..::.|:.|   |.  |:
Mouse    14 PKLSPDLPQHSKARQTMAPRRARKRVEGTASSNVFSMFDQS------QIQEFKEAFTIMDQ--NR 70

  Fly   388 SGIFDSNQLLLAKHALGGVVIGGSRVLQCRYEFEAQAPERV-QIRFHDFNVPTEHENSTGCQPGD 451
            .|..|...|.....|||.:.:...       |.||...|.. .|.|..| :....|...|..|.:
Mouse    71 DGFIDKEDLRDTFAALGRINVKNE-------ELEAMVKEAPGPINFTVF-LTMFGEKLKGTDPEE 127

  Fly   452 A-LHVV----TELRG----------------RYETQELLCGAFLPKPLMSSGQ------------ 483
            . ||..    ||.:|                |:..:|.||...||.|    ||            
Mouse   128 TILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEEESLCNPQLPFP----GQADVCSFPARCLW 188

  Fly   484 QLHLQ 488
            ||.||
Mouse   189 QLRLQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 27/108 (25%)
CUB 527..644 CDD:238001
Myl10XP_017176539.1 FRQ1 44..164 CDD:227455 28/135 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.