Sequence 1: | NP_001097756.1 | Gene: | CG34402 / 41513 | FlyBaseID: | FBgn0085431 | Length: | 695 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017176539.1 | Gene: | Myl10 / 59310 | MGIID: | 1891705 | Length: | 232 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 45/200 - (22%) |
---|---|---|---|
Similarity: | 64/200 - (32%) | Gaps: | 57/200 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 326 PNASVPPPAVLEAASVVVKQEKLQQEQASAAKENSLMSDVELSKPGRSFEQCKQTF---DSRVNK 387
Fly 388 SGIFDSNQLLLAKHALGGVVIGGSRVLQCRYEFEAQAPERV-QIRFHDFNVPTEHENSTGCQPGD 451
Fly 452 A-LHVV----TELRG----------------RYETQELLCGAFLPKPLMSSGQ------------ 483
Fly 484 QLHLQ 488 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG34402 | NP_001097756.1 | CUB | 195..318 | CDD:238001 | |
CUB | <414..512 | CDD:238001 | 27/108 (25%) | ||
CUB | 527..644 | CDD:238001 | |||
Myl10 | XP_017176539.1 | FRQ1 | 44..164 | CDD:227455 | 28/135 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0031 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |