DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and cdcp2

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:XP_021324134.1 Gene:cdcp2 / 567759 ZFINID:ZDB-GENE-070705-485 Length:544 Species:Danio rerio


Alignment Length:489 Identity:96/489 - (19%)
Similarity:152/489 - (31%) Gaps:158/489 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 GEEANMGQGYF-----------------HSPQFPAHYPAHIKCAYKFIGRPDTHVEILFEELQLP 252
            |.|:...|.||                 .||.||..||....|.:..:....:.|.:.|...:|.
Zfish    23 GSESGFRQRYFCLGVKCGGILSASSGNVSSPNFPGLYPYDTDCTWLIVVSEGSSVLLTFHHFELE 87

  Fly   253 PVVSGGCQLDALTLFDAESAHMNSVIDVICSSRPTRRLVSTGPDLLLEFNASSNRTAKGFRGKYK 317
              ....|..|.:.:::..|....:::...|......:..|:...:.:.|::..:...|||...|:
Zfish    88 --YHTDCAYDYIKIYNGISEDEGNLLGKFCGDVSPPQFSSSWNVMSIIFHSDRHVARKGFLVGYR 150

  Fly   318 FVSNDLGVPNASVPPPAVLEAASVVVKQEKLQQEQASAAKENSLMSDVELSKPGRSFEQCKQTFD 382
                                                                             
Zfish   151 ----------------------------------------------------------------- 150

  Fly   383 SRVNKSGIFDSNQLLLAKHALGGVVIGGSRVL-------------QCRYEFEAQAPERVQIRFHD 434
                             |...|||:.|.|.|:             :|.:..:......|.:.|.|
Zfish   151 -----------------KDMCGGVLTGLSGVIASPGYPQDYSNNAECSWTVQVSNQSLVSLVFLD 198

  Fly   435 FNVPTEHENSTGCQPG-----DALHVVTELRGRYETQELLCGAFLPKPLMSSGQQLHLQFVGKYP 494
            |.:    ||:.||...     |...|.....|.|      ||...|...:::..||.:.|...: 
Zfish   199 FQL----ENNEGCNFDYVALFDGPTVKHHHLGNY------CGNEQPPNTITTSNQLLVVFKSDF- 252

  Fly   495 PTMTNKVQYYGFRAEYRFLTNFGIMSGIQKEGCSFVYNSSERISGLFHSPNFPGYYLENVVCNYY 559
                 .:...||:|.|        .||   |...|:    :.|||.|.||::|..|..|:.|::.
Zfish   253 -----NIGGRGFKAYY--------FSG---ECQQFL----KDISGNFTSPHYPNIYPNNINCHWT 297

  Fly   560 FYGASDERVVLHFTYFDIEGIGS----CDHQTASDYIEFSNFMSTDRKFSRYCGKLPDFEMRSDG 620
            ...|:..||.|.|.:.::|...|    ||:.:.:.|   ......|....::||......:.|.|
Zfish   298 ITLAAGYRVKLFFPFLELEDRNSLTSMCDYDSVAVY---DGDSEADSVLGQWCGSEQPPSLTSRG 359

  Fly   621 RFFRVTLHSNDRFVAIGFRALYTFETVSVNNSIT 654
            ....|.|:::..|...||.|.| ...|.||.|.|
Zfish   360 NKLLVVLNTDRNFAFKGFTASY-LGVVPVNISCT 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 25/129 (19%)
CUB <414..512 CDD:238001 23/115 (20%)
CUB 527..644 CDD:238001 33/120 (28%)
cdcp2XP_021324134.1 CUB 39..145 CDD:278839 17/107 (16%)
CUB 154..265 CDD:238001 29/134 (22%)
CUB 276..381 CDD:238001 30/107 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5088
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.