DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and pcolcea

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001025352.2 Gene:pcolcea / 563867 ZFINID:ZDB-GENE-041014-370 Length:479 Species:Danio rerio


Alignment Length:167 Identity:38/167 - (22%)
Similarity:66/167 - (39%) Gaps:24/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 HSFCDFYFFASLSGEEANMGQGYFHSPQFP-AHYPAHIKCAYKFIGRPDTHVEILFEELQLPPVV 255
            |.||         |.:....||...:|.:| .:||..|.|::.....|:..:|:.|::..|..  
Zfish   154 HQFC---------GGKLTKSQGTIKTPNWPEKNYPPGISCSWLITVEPEMVIEVKFDKFDLES-- 207

  Fly   256 SGGCQLDALTLFDAESAHMNSVIDVICSSRPTRRLVSTGPDLLLEFNASSNRTAKGFRGKYKFVS 320
            ...|:.|.:..|:......:..|...|.....:.:|:....||::|.:..:.|:.||...|..:.
Zfish   208 DTYCRFDYVAFFNGGEKDDSRRIGKYCGYTAPQNIVTNSNVLLVQFVSDLSVTSDGFMASYTSIP 272

  Fly   321 NDLGVPNA-----------SVP-PPAVLEAASVVVKQ 345
            ..|..|:|           |.| .|.::.|..||..:
Zfish   273 RGLHSPSAGGDVVSGPRVSSTPTKPKIIPAKPVVTTE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 27/123 (22%)
CUB <414..512 CDD:238001
CUB 527..644 CDD:238001
pcolceaNP_001025352.2 CUB 35..144 CDD:238001
CUB 157..270 CDD:238001 27/123 (22%)
NTR_PCOLCE 355..479 CDD:239631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5088
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.