DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and PDGFC

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_057289.1 Gene:PDGFC / 56034 HGNCID:8801 Length:345 Species:Homo sapiens


Alignment Length:181 Identity:46/181 - (25%)
Similarity:71/181 - (39%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   502 QYYGFRAEYRFLTNFGIMSGIQKEGCSFVYNSSERI-----SGLFHSPNFPGYYLENVVCNYYFY 561
            |..|.:||....:.|...|..::.|.....:  |||     :|..|||.||..|..|.|..:...
Human    16 QRQGTQAESNLSSKFQFSSNKEQNGVQDPQH--ERIITVSTNGSIHSPRFPHTYPRNTVLVWRLV 78

  Fly   562 GASDERVVLHFTYFDIEGIGSCDHQTAS-DYIEFSNFMSTDRKFSRYCGK--LPDFEMRSDGRFF 623
             |.:|.|.:..|:.:..|:...:..... |::|... .|......|:||.  :|..:: |.|...
Human    79 -AVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEE-PSDGTILGRWCGSGTVPGKQI-SKGNQI 140

  Fly   624 RVTLHSNDRFVA-IGFRALYTF------ETVS-------------VNNSIT 654
            |:...|::.|.: .||...|..      |.||             :||:||
Human   141 RIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAIT 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001
CUB <414..512 CDD:238001 4/9 (44%)
CUB 527..644 CDD:238001 32/125 (26%)
PDGFCNP_057289.1 CUB 49..162 CDD:238001 30/115 (26%)
PDGF 248..340 CDD:238079
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.