powered by:
Protein Alignment CG34402 and neto1
DIOPT Version :9
Sequence 1: | NP_001097756.1 |
Gene: | CG34402 / 41513 |
FlyBaseID: | FBgn0085431 |
Length: | 695 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017214681.1 |
Gene: | neto1 / 556922 |
ZFINID: | ZDB-GENE-070912-592 |
Length: | 93 |
Species: | Danio rerio |
Alignment Length: | 57 |
Identity: | 20/57 - (35%) |
Similarity: | 28/57 - (49%) |
Gaps: | 5/57 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 520 SGIQKEG-C-SFVYNSSERISGLFHSPNFPGYYLENVVCNYYFYGASDERVVLHFTY 574
||:...| | |:: .|...|||.|||:|..|..:..|.|....|..:.:.|:|.|
Zfish 36 SGVTPVGLCGSWI---KETNGGLFTSPNYPEKYPPDRECIYIIEAAPRQCIDLYFDY 89
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34402 | NP_001097756.1 |
CUB |
195..318 |
CDD:238001 |
|
CUB |
<414..512 |
CDD:238001 |
|
CUB |
527..644 |
CDD:238001 |
17/49 (35%) |
neto1 | XP_017214681.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.