DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34402 and tll2l

DIOPT Version :9

Sequence 1:NP_001097756.1 Gene:CG34402 / 41513 FlyBaseID:FBgn0085431 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001016661.1 Gene:tll2l / 549415 XenbaseID:XB-GENE-478930 Length:500 Species:Xenopus tropicalis


Alignment Length:351 Identity:75/351 - (21%)
Similarity:117/351 - (33%) Gaps:106/351 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FTVSHWP-------------LTMPAASLALGLTVVLLATGNGQSQQAVTNSKQSHFWLD------ 50
            ::|.|:|             :|.|..::.:|            .:..:||       ||      
 Frog   219 YSVMHYPRNAFSISPFLPTLITKPDPTIQIG------------QRYGLTN-------LDIAKINK 264

  Fly    51 ------CSCLHLSERNATQWGRLAINASHSLGAKNNCLMIFIAGMDDELVAFQLEQLQLRAGCL- 108
                  ||.| ||:.|.|.:.....:|...   ..||:.:.....:...|.|....||....|: 
 Frog   265 LYNCDVCSTL-LSDVNGTLFSPSYPSAYPD---NANCVWLIRIPSNQVSVQFIAFSLQTSQNCVS 325

  Fly   109 DSVDIFPYLREPVIENAT----LAADTFCQHSRERSATPIYSAGRLLGLRLRFQQPPTDLASWNL 169
            |.|.|:        :.||    :..|..|              |.||       .||. .||.||
 Frog   326 DYVKIY--------DGATRSDPVLLDKAC--------------GSLL-------LPPI-TASSNL 360

  Fly   170 TLNASYRFLKRENFRTDGRLVPHSFCDFYFFASLSGEEANMGQGYFHSPQFPAHYPAHIKCAYKF 234
            .|   ..|:..|.....|      |...|...|..|...:.... |.||.:|..||....|.:..
 Frog   361 ML---LEFVSNEGNTMTG------FEATYSTVSCGGTYTSQSNS-FSSPGYPVAYPPLTTCIWSI 415

  Fly   235 IGRPDTHVEILFEELQLPPVVSGG--CQLDALTLFDAESAHMNSVIDVI---CSSRPTRRLVSTG 294
            .......:.:...:::    |..|  |..|:||::|.    .|:...::   |.:......:|.|
 Frog   416 YAPVGFKIVLTINKIE----VEYGLLCMYDSLTIYDG----YNTTAPILRCACGNTAVPNQISRG 472

  Fly   295 PDLLLEFNASSNRTAKGFRGKYKFVS 320
            ..:||.|::..:...|||:..|..:|
 Frog   473 RSMLLVFSSDISVQKKGFQASYTLIS 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34402NP_001097756.1 CUB 195..318 CDD:238001 28/127 (22%)
CUB <414..512 CDD:238001
CUB 527..644 CDD:238001
tll2lNP_001016661.1 ZnMc_hatching_enzyme 86..268 CDD:239810 10/67 (15%)
CUB 272..382 CDD:238001 36/152 (24%)
CUB 385..495 CDD:238001 25/118 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.